[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87533.2
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  618/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->155 3hhgG PDBj 7e-11 32.8 %
:RPS:PDB   6->215 1b9nB PDBj 2e-20 10.6 %
:RPS:SCOP  6->111 1b9mA1  a.4.5.8 * 5e-19 14.2 %
:RPS:SCOP  100->293 1ixcA2  c.94.1.1 * 2e-14 11.4 %
:HMM:SCOP  12->121 1b9mA1 a.4.5.8 * 1.7e-25 42.9 %
:HMM:SCOP  96->296 1uthA_ c.94.1.1 * 1.4e-22 25.6 %
:RPS:PFM   17->73 PF00126 * HTH_1 9e-11 57.9 %
:HMM:PFM   97->251 PF03466 * LysR_substrate 3.5e-24 32.9 152/209  
:HMM:PFM   17->73 PF00126 * HTH_1 1.3e-23 54.4 57/60  
:BLT:SWISS 12->288 DGDR_BURCE 1e-32 32.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87533.2 GT:GENE AAK87533.2 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1749211..1750107) GB:FROM 1749211 GB:TO 1750107 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID AAK87533.2 GB:DB_XREF GI:159140184 LENGTH 298 SQ:AASEQ MTVTFRQPLPLLDNDILRTFVAIAETGNFSTAAEVVFRTPSAVSMQIKKLEEQLKTTLFLRDARSVTLTAHGETLLTYARRMIALSNEAVSRFVMPELSGVVRLGAPEDIGERGLLPGILKRFADVFPGIMIDVTIDSSSNLYKRMDEQRLDLALVNCASHPLRDTGEVLMRERLVWAGAKCGTAYLRDPLPISIWEEGCIWRSEAIVSLERRGRNFRVAYLSGHTMAQRAAIAADLAIAPLPRSYVQNDLVILGDKEGLPELGSFDIRLIMGDKASRPVLAVAESIRNAFVEVAKAA GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 12->288|DGDR_BURCE|1e-32|32.8|274/294| SEG 228->244|aqraaiaadlaiaplpr| BL:PDB:NREP 1 BL:PDB:REP 13->155|3hhgG|7e-11|32.8|137/294| RP:PDB:NREP 1 RP:PDB:REP 6->215|1b9nB|2e-20|10.6|199/245| RP:PFM:NREP 1 RP:PFM:REP 17->73|PF00126|9e-11|57.9|57/60|HTH_1| HM:PFM:NREP 2 HM:PFM:REP 97->251|PF03466|3.5e-24|32.9|152/209|LysR_substrate| HM:PFM:REP 17->73|PF00126|1.3e-23|54.4|57/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 6->111|1b9mA1|5e-19|14.2|106/122|a.4.5.8| RP:SCP:REP 100->293|1ixcA2|2e-14|11.4|193/205|c.94.1.1| HM:SCP:REP 12->121|1b9mA1|1.7e-25|42.9|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 96->296|1uthA_|1.4e-22|25.6|199/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3668 OP:NHOMOORG 629 OP:PATTERN -----------------------------------111------------------------------ 354162-----1--32211-11--15111111----528B-41511---111333--1--23--2134522-111-----131-1111--11--------14-1-1-1--------------------------1-45513---2141131112322111111211422111111111111111211----4265555556545555652-9859557222812-2221219F1--------------1--11-124334221244--212-2--21-11--------------------------------------------2387111124232314331122721-14332134431111311-11-111115111-1--183B9F214754767767777666C-7C685D8A5K21LIIBCADOPGIIAE43379D76684853333333377665333-----------------------------1-3B127LJDISbdegZG9998NNOYA8AB79hQTLRGK-1DD83A521I3C1UD5723222B511232231-1145123-2231214--2-2-244424123-33413---------------------1---44886154B2764833432B62353638657C---1234------D7A94A88778898877-87879777A7888568768FKGCA15AB799A8BAB9A9B999F68666662-644444444444---2-2-113333-4C7L2112-2-211211119A99B45173D2ONLNIPMRBNRQK5EDI-12-211211677A555558B8A9573343311-------2---------------1--------------------------------------31 --------------------------------------------------------------------------------------------------------------------------------------------------------------3----1------5--1-1---------1--3-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 76.2 SQ:SECSTR TccTHETTEEEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTTcccTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEcHEEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEEcTTcH####################################################################### DISOP:02AL 1-7,90-100,297-299| PSIPRED cccccccccccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEEcccccccEEEEEEEEccEEEEEccccccccccccEEEEcccccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHccccEEHHHHHHcccccEEEcccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcc //