[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87542.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   49->175 3dtdD PDBj 7e-24 22.6 %
:RPS:PFM   49->175 PF06776 * IalB 1e-19 37.3 %
:HMM:PFM   49->176 PF06776 * IalB 9.6e-36 36.2 127/134  
:HMM:PFM   163->212 PF01237 * Oxysterol_BP 0.00041 32.0 50/354  
:BLT:SWISS 49->175 Y368_BRUA2 5e-12 35.5 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87542.2 GT:GENE AAK87542.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1757191..1757847) GB:FROM 1757191 GB:TO 1757847 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87542.2 GB:DB_XREF GI:159140189 LENGTH 218 SQ:AASEQ MMQKANTFTRTALSALVLSLGAVSAPAISQAQDAAPAAQGGAGAPPLGWFKTCSKQEDNDVCVVQNVVLAQNGQMITAVGLITVEGKVNRKLLQVSVPTARLIPPGVMMQIDGGKGQKLDYAVCLPDKCTAEVPLTDAMIASLKKGSEVVFTSINFRRAPNPIKIALSGFTGAYDGAAITQSQLAESQRSLQEGMQKKAEEARKKLEAAQDAAKAPKP GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 49->175|Y368_BRUA2|5e-12|35.5|124/173| COIL:NAA 34 COIL:NSEG 1 COIL:REGION 182->215| SEG 12->46|alsalvlslgavsapaisqaqdaapaaqggagapp| SEG 197->209|kkaeearkkleaa| RP:PDB:NREP 1 RP:PDB:REP 49->175|3dtdD|7e-24|22.6|124/145| RP:PFM:NREP 1 RP:PFM:REP 49->175|PF06776|1e-19|37.3|126/133|IalB| HM:PFM:NREP 2 HM:PFM:REP 49->176|PF06776|9.6e-36|36.2|127/134|IalB| HM:PFM:REP 163->212|PF01237|0.00041|32.0|50/354|Oxysterol_BP| OP:NHOMO 60 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-11111111111122222222122-1-1111--11--1111111111111------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 68.3 SQ:SECSTR ###############################################TEEEEEEEETTEEEEEEEEEEEcTTccEEEEEEEEcTTccEEEEEEEEEEcccccTTccEEEEETTccEEEEcccEEETTEEEEEEEEcHHHHHHHHHccEEEEcccTTccEEEEEEEEcTTHHHHHHHHHHHHHHHTTTcccccccEE###################### DISOP:02AL 1-4,26-46,187-219| PSIPRED ccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEcccccccEEEEEEEEEcccccEEEEEEEEEcccccccEEEEEEccHHHHcccccEEEEccccEEEEEEEEEcccccEEEEcccHHHHHHHHcccEEEEEEEcccccccccEEccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //