[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87546.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->53 PF09925 * DUF2157 0.00067 20.0 50/145  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87546.1 GT:GENE AAK87546.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1761753..1762097) GB:FROM 1761753 GB:TO 1762097 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87546.1 GB:DB_XREF GI:15156880 LENGTH 114 SQ:AASEQ MWTNINRFATAGLVALTIAGTTIATTSQAEARNNFGRGLAAGIAGTIIGGALIAGARHPGYAYGPAYYAPAYGPPTYAAPVYGPPVVYQPVYPRCHIAWRQNAWGDMYRVRVCD GT:EXON 1|1-114:0| SEG 17->26|tiagttiatt| SEG 38->56|glaagiagtiiggaliaga| SEG 59->93|pgyaygpayyapaygpptyaapvygppvvyqpvyp| HM:PFM:NREP 1 HM:PFM:REP 2->53|PF09925|0.00067|20.0|50/145|DUF2157| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-32,34-34,39-40,45-46,48-48,53-53,81-81,87-88,90-90,95-95,114-115| PSIPRED ccccHHHHHcccEEEEEEEccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEcccccccEEEEEEccccccEEEEEEcc //