[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87549.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.218.1
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->86 1puzA PDBj 1e-08 32.4 %
:RPS:SCOP  8->86 1puzA  a.218.1.1 * 2e-11 30.8 %
:HMM:SCOP  8->89 1puzA_ a.218.1.1 * 1.4e-22 39.0 %
:RPS:PFM   20->70 PF03937 * Sdh5 2e-06 45.1 %
:HMM:PFM   20->70 PF03937 * Sdh5 6.3e-23 43.1 51/51  
:HMM:PFM   59->87 PF10595 * UPF0564 0.00036 31.0 29/356  
:BLT:SWISS 6->79 SDH5_CANGA 1e-09 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87549.2 GT:GENE AAK87549.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1765995..1766306) GB:FROM 1765995 GB:TO 1766306 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87549.2 GB:DB_XREF GI:159140193 LENGTH 103 SQ:AASEQ MTGLVRTSADLDPRRRRILYRCWHRGIREMDLVLGQFAEDNIAGLSDEQLDELEIIMAEEDNDLVQMVTGAQPVPEKFQTPLFEKIASYRPDFDLVTAETLKA GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 6->79|SDH5_CANGA|1e-09|36.5|74/153| BL:PDB:NREP 1 BL:PDB:REP 12->86|1puzA|1e-08|32.4|74/82| RP:PFM:NREP 1 RP:PFM:REP 20->70|PF03937|2e-06|45.1|51/51|Sdh5| HM:PFM:NREP 2 HM:PFM:REP 20->70|PF03937|6.3e-23|43.1|51/51|Sdh5| HM:PFM:REP 59->87|PF10595|0.00036|31.0|29/356|UPF0564| RP:SCP:NREP 1 RP:SCP:REP 8->86|1puzA|2e-11|30.8|78/82|a.218.1.1| HM:SCP:REP 8->89|1puzA_|1.4e-22|39.0|82/82|a.218.1.1|1/1|YgfY-like| OP:NHOMO 83 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111111111111--111111111111111-111111111111111111-111111111111-1-1--1----------11----11111111111----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 71.8 SQ:SECSTR ###########HHHHHHHHHHc#ccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHTccHHHHHHHHHTccccccTTHHHHHHHH################# DISOP:02AL 1-4,6-7,97-98,100-104| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHcc //