Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87551.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:BLT:SWISS 17->87 53DR_CHLTE 2e-05 28.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87551.1 GT:GENE AAK87551.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1768612..1768884 GB:FROM 1768612 GB:TO 1768884 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87551.1 GB:DB_XREF GI:15156887 LENGTH 90 SQ:AASEQ MNMIDPRRPPPAFRKGYALCSPQNVLQPDTFAKSQKKAIGKQFKKPGRKSAWAQALEEGWTVRLVYMRLFVPVFHATTTGTEVDDLDDED GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 17->87|53DR_CHLTE|2e-05|28.2|71/202| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 33-49, 84-90| PSIPRED cccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccc //