[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87571.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->53 PF08653 * DASH_Dam1 0.00025 37.5 24/58  
:BLT:SWISS 12->53 SYE_BIFLO 9e-04 31.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87571.1 GT:GENE AAK87571.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1787627..1787818) GB:FROM 1787627 GB:TO 1787818 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87571.1 GB:DB_XREF GI:15156911 LENGTH 63 SQ:AASEQ MSEYGRFFAHLPCPEGMRHSPRIKNGLFRFGEAHDSVAVLLVKMQDTEAIHENCRECERTPFL GT:EXON 1|1-63:0| BL:SWS:NREP 1 BL:SWS:REP 12->53|SYE_BIFLO|9e-04|31.0|42/506| HM:PFM:NREP 1 HM:PFM:REP 30->53|PF08653|0.00025|37.5|24/58|DASH_Dam1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccEEEEccccccccccccHHHHHHHcccccccEEEEEEEcccHHHHHHHHHHHHccccc //