[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87580.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->132 1xd7A PDBj 3e-04 28.4 %
:HMM:SCOP  6->134 1xd7A_ a.4.5.55 * 8.2e-30 34.6 %
:RPS:PFM   26->82 PF02082 * Rrf2 7e-04 33.3 %
:HMM:PFM   2->82 PF02082 * Rrf2 8.7e-22 39.5 81/83  
:BLT:SWISS 26->132 YWNA_BACSU 9e-06 27.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87580.2 GT:GENE AAK87580.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1792891..1793313) GB:FROM 1792891 GB:TO 1793313 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87580.2 GB:DB_XREF GI:159140208 LENGTH 140 SQ:AASEQ MMKTDGRLARMLHVLVHMGLLGGRETSERIAQMLNTNPVVVRRTLGALRESGIVVSEGGRGGGWKLIRSLDQITVLDVQRALVEGQMLPAPLSKDHPNCPVERASNAVLERAHCLAEAALRTAYSETTLAQIAETAVATK GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 26->132|YWNA_BACSU|9e-06|27.4|106/133| SEG 10->24|rmlhvlvhmgllggr| SEG 50->63|esgivvseggrggg| BL:PDB:NREP 1 BL:PDB:REP 26->132|1xd7A|3e-04|28.4|95/116| RP:PFM:NREP 1 RP:PFM:REP 26->82|PF02082|7e-04|33.3|57/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 2->82|PF02082|8.7e-22|39.5|81/83|Rrf2| HM:SCP:REP 6->134|1xd7A_|8.2e-30|34.6|127/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 67 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------1-----------------------------------------------------------------------------1--------------------------------------------------------------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------1------1-11----------1-1-----1---1-133----111-1---1-----------------------11----------------------------------1------11-1211-1111---11111-1------1----------1---1--1----------------------------------------------1-1-----------------------------------1-1-----------1-------------------------------------------------------------------------------------------------------------------------1-1--------------------------11111---1------------------------------------1111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 67.9 SQ:SECSTR #########################cHHHHHHHHTccHHHHHHHHHHHHHTTcEEcccccccc#EEcccGGGccHHHHHHHH###########ccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHH######## DISOP:02AL 1-2,4-4,139-141| PSIPRED cccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHccccccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcc //