[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87595.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  270/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->220 2i3dB PDBj e-122 99.1 %
:RPS:PDB   10->196 3dd5C PDBj 7e-13 12.2 %
:RPS:SCOP  2->219 2i3dA1  c.69.1.36 * 3e-25 97.7 %
:HMM:SCOP  17->214 1mpxA2 c.69.1.21 * 2.2e-31 26.4 %
:RPS:PFM   17->139 PF02129 * Peptidase_S15 3e-11 30.0 %
:HMM:PFM   18->138 PF02129 * Peptidase_S15 1.4e-09 20.4 108/272  
:HMM:PFM   83->194 PF01738 * DLH 2.3e-07 22.5 111/217  
:BLT:SWISS 1->207 Y471_RICPR 1e-61 51.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87595.1 GT:GENE AAK87595.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1806158..1806835 GB:FROM 1806158 GB:TO 1806835 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87595.1 GB:DB_XREF GI:15156937 LENGTH 225 SQ:AASEQ MPEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELMGECEDYLDRRLNGELVPEPAAKRIR GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 1->207|Y471_RICPR|1e-61|51.2|207/238| BL:PDB:NREP 1 BL:PDB:REP 2->220|2i3dB|e-122|99.1|214/214| RP:PDB:NREP 1 RP:PDB:REP 10->196|3dd5C|7e-13|12.2|181/193| RP:PFM:NREP 1 RP:PFM:REP 17->139|PF02129|3e-11|30.0|120/238|Peptidase_S15| HM:PFM:NREP 2 HM:PFM:REP 18->138|PF02129|1.4e-09|20.4|108/272|Peptidase_S15| HM:PFM:REP 83->194|PF01738|2.3e-07|22.5|111/217|DLH| GO:PFM:NREP 2 GO:PFM GO:0004177|"GO:aminopeptidase activity"|PF02129|IPR000383| GO:PFM GO:0006508|"GO:proteolysis"|PF02129|IPR000383| RP:SCP:NREP 1 RP:SCP:REP 2->219|2i3dA1|3e-25|97.7|218/218|c.69.1.36| HM:SCP:REP 17->214|1mpxA2|2.2e-31|26.4|193/0|c.69.1.21|1/1|alpha/beta-Hydrolases| OP:NHOMO 284 OP:NHOMOORG 277 OP:PATTERN -------------------------------------------------------------------- 111-----------------------------------------------------------------------------------------------------------------------------------1---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122221111111111111-111111---111111111111111-1-1--------------------1111--11-------------------------11---------------------------------------------------------------------------------------------------------------------------------1111111111-1------------------111111111111111111111222111111111111111--------------11111111111111----------------------------------------------------------- ------------11--------------------------------------------------------------------------------1-------------------------------------------------------------------------------1---1---------1---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 97.8 SQ:SECSTR EEEEEcccEccccHHHHccTTccccEEEEEEccTTccTTTcccHHHHHHHHHHcGGGEEEEEccTTccccGGGGGcTTcccHHHHHHHHHHHHHHHcTTcEEEEEEETHHHHHHHHHHHTccHEEEEEEEccTTTTTTTTccTTccGGGEEEEccTTcGGGGTcccccccccHHTGTcccHHHHHTHHHHHHHHHHHHHcccccHHHHHHHHcccEEEcc##### DISOP:02AL 219-225| PSIPRED ccEEEEcccccEEEEEEEccccccccEEEEEccccccccccccHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHHHHccHHccccccccccc //