[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87603.1
DDBJ      :             mutT like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->48 3cngC PDBj 4e-04 44.1 %
:BLT:PDB   27->146 1ryaA PDBj 6e-05 27.7 %
:RPS:PDB   15->144 2b0vA PDBj 1e-20 14.6 %
:RPS:SCOP  15->140 2b0vA1  d.113.1.1 * 2e-19 14.3 %
:HMM:SCOP  1->144 1ryaA_ d.113.1.5 * 2.9e-33 37.1 %
:RPS:PFM   19->129 PF00293 * NUDIX 1e-10 37.6 %
:HMM:PFM   17->135 PF00293 * NUDIX 8e-26 27.7 119/135  
:BLT:SWISS 11->129 NUDT1_ARATH 6e-08 30.3 %
:PROS 48->69|PS00893|NUDIX_BOX
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87603.1 GT:GENE AAK87603.1 GT:PRODUCT mutT like protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1817584..1818027 GB:FROM 1817584 GB:TO 1818027 GB:DIRECTION + GB:PRODUCT mutT like protein GB:PROTEIN_ID AAK87603.1 GB:DB_XREF GI:15156947 LENGTH 147 SQ:AASEQ MDNMTSTIKPGLDFPGVGVGLVILREGRLLLCRRMKAPEAGYWSIPGGKVDHLETCLAAARREAEEETGLQIGAVEFLCHSEFIDPQDRHHWVSLIFVTRDTQGEPALTEPDKLSAIGWFDPDKLPEPLSAFAKDALAALNQGRTGN GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 11->129|NUDT1_ARATH|6e-08|30.3|119/147| PROS 48->69|PS00893|NUDIX_BOX|PDOC00695| SEG 58->67|aaarreaeee| BL:PDB:NREP 2 BL:PDB:REP 15->48|3cngC|4e-04|44.1|34/174| BL:PDB:REP 27->146|1ryaA|6e-05|27.7|119/160| RP:PDB:NREP 1 RP:PDB:REP 15->144|2b0vA|1e-20|14.6|130/146| RP:PFM:NREP 1 RP:PFM:REP 19->129|PF00293|1e-10|37.6|109/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 17->135|PF00293|8e-26|27.7|119/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 15->140|2b0vA1|2e-19|14.3|126/146|d.113.1.1| HM:SCP:REP 1->144|1ryaA_|2.9e-33|37.1|143/160|d.113.1.5|1/1|Nudix| OP:NHOMO 66 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- --------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------111-----------11-11-1-------------------------111111111111---1-----------11111111---------------------------------------------------------------11111--------------------------------------------1--1---------------------------1-1---------------------------11-----1----------1---------1--------------------------------------------------------11-----------------1------------------1-----------------------------------------------11-1-1------------------------------1-1--1-11111111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 95.9 SQ:SECSTR ######HHTTTccEcEEEEEEEcEETTEEEEEEEcccccccEEEccEEEccTTccHHHHHHHHHHHHHcEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEcTTccccTTEEEEEEEEHHHHHHTGccTHHHHHHHHHTTcTTc DISOP:02AL 1-6, 144-147| PSIPRED ccccccccccHHccccEEEEEEEEcccEEEEEEEcccccccEEEccccEEcccccHHHHHHHHHHHHcccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEccccccccccccccEEEEccHHHHHHHccHHHHHHHHHHHcccccc //