[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87608.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:168 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87608.1 GT:GENE AAK87608.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1822138..1822644 GB:FROM 1822138 GB:TO 1822644 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87608.1 GB:DB_XREF GI:15156954 LENGTH 168 SQ:AASEQ MESDRKGFRETASAALFLALGALAWALCSAAVATIGLYIRNRLETDHAADIITLFFCGGLLGWLLAIVALRFLPASTSLPLRFAAACLAIAFFTLAVAAAFFAFQYRIFYAQWHAPAFSRIWFFQQLFTSLGAVYQFAILGLGLYFPFAALPLLPAGAILCRRARQAT GT:EXON 1|1-168:0| TM:NTM 4 TM:REGION 15->37| TM:REGION 50->72| TM:REGION 83->105| TM:REGION 135->157| SEG 12->33|asaalflalgalawalcsaava| SEG 58->65|ggllgwll| SEG 89->104|aiafftlavaaaffaf| SEG 142->160|lglyfpfaalpllpagail| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 166-168| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //