[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87613.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->63 PF05963 * Cytomega_US3 0.00043 20.8 48/187  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87613.1 GT:GENE AAK87613.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1826694..1827098 GB:FROM 1826694 GB:TO 1827098 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87613.1 GB:DB_XREF GI:15156959 LENGTH 134 SQ:AASEQ MSLAFRLNAYKATGLILAAAALAACQPKPQPVASVSRAALPTMERIALGANACWFKSGDAAFKAYRLAPELNSFSGRPRILLVPRNSPESRPMLVIQAEGNPAKLDAFGPVMSEAISGRIATDVKRWANGGKGC GT:EXON 1|1-134:0| SEG 17->24|laaaalaa| HM:PFM:NREP 1 HM:PFM:REP 16->63|PF05963|0.00043|20.8|48/187|Cytomega_US3| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------11--111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 31-33, 132-134| PSIPRED ccEEEEHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccEEEEEEccccccccEEEEEEccccccHHHHHHHHHcHHHHHHHHHHHHHHcccccc //