[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87616.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.1
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  45->196 1qj8A  f.4.1.1 * 1e-04 13.4 %
:HMM:PFM   54->196 PF09411 * PagL 7.7e-34 27.8 133/139  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87616.1 GT:GENE AAK87616.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1829261..1829851 GB:FROM 1829261 GB:TO 1829851 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87616.1 GB:DB_XREF GI:15156964 LENGTH 196 SQ:AASEQ MAAFGSTSIRVLFALAMVFAAFVLADVTSAIAADGTVFDELRFGVTTSVTSRDSGGEDGAFPAFTAYFDPFASASAVTLGEKLARPRLHLGGEIGTEGEADTIYGGVNWTFDLNPKIFVDLGFGGLWHDGRLKNGPGETGAEFGCHLLFHEYAAIGYRFNSNWNISTQIEHASHANLCDGPNDGLTRVGLMVGYKF GT:EXON 1|1-196:0| TM:NTM 1 TM:REGION 2->24| SEG 11->25|vlfalamvfaafvla| HM:PFM:NREP 1 HM:PFM:REP 54->196|PF09411|7.7e-34|27.8|133/139|PagL| RP:SCP:NREP 1 RP:SCP:REP 45->196|1qj8A|1e-04|13.4|142/148|f.4.1.1| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-1-1111111-2111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccEEEcccccccccccccccEEEEEEccccccccHHHHHHHcccccEEEEEEEccccccEEEEEEEEEEEEcccEEEEEcccEEEEccccccccccccHHHcccccccccHHccEEEcccEEEEEEEEEccccEEEEcccccHHHHHHEEEEcc //