[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87618.2
DDBJ      :             BolA/YrbA family protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  168/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.6
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->77 1xs3A PDBj 2e-12 41.9 %
:RPS:SCOP  1->77 1v9jA  d.52.6.1 * 4e-20 23.7 %
:HMM:SCOP  1->77 1v9jA_ d.52.6.1 * 9.4e-23 42.1 %
:RPS:PFM   11->77 PF01722 * BolA 4e-13 43.3 %
:HMM:PFM   12->77 PF01722 * BolA 7.6e-21 36.9 65/75  
:BLT:SWISS 8->77 Y3122_SYNY3 1e-14 52.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87618.2 GT:GENE AAK87618.2 GT:PRODUCT BolA/YrbA family protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1832217..1832450 GB:FROM 1832217 GB:TO 1832450 GB:DIRECTION + GB:PRODUCT BolA/YrbA family protein GB:PROTEIN_ID AAK87618.2 GB:DB_XREF GI:159140224 LENGTH 77 SQ:AASEQ MPMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEAFKGKTRVQQHQMVYDALKGNMGGVLHALALQTSAPE GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 8->77|Y3122_SYNY3|1e-14|52.2|69/85| BL:PDB:NREP 1 BL:PDB:REP 2->77|1xs3A|2e-12|41.9|74/80| RP:PFM:NREP 1 RP:PFM:REP 11->77|PF01722|4e-13|43.3|67/71|BolA| HM:PFM:NREP 1 HM:PFM:REP 12->77|PF01722|7.6e-21|36.9|65/75|BolA| RP:SCP:NREP 1 RP:SCP:REP 1->77|1v9jA|4e-20|23.7|76/113|d.52.6.1| HM:SCP:REP 1->77|1v9jA_|9.4e-23|42.1|76/113|d.52.6.1|1/1|BolA-like| OP:NHOMO 177 OP:NHOMOORG 172 OP:PATTERN ---------------------------1-111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------1111111211111111111111111-111---1-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-111111111111111111--1111221111111111111111111111111111111111--------------------1-11111111-------------------1---------1---1---1-----------11-11-1---------11--11----------------------------1----------------------------11---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111----111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 96.1 SQ:SECSTR #ccHHHHHHHHHHHHccccEEEEE##ccTTcccEEEEEcGGGcccccHHHHHHHHHHTTcTTTTcccccEEEEEcGG DISOP:02AL 1-3,76-78| PSIPRED ccccHHHHHHHHHHHccccEEEEEEccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEEEccc //