[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87622.2
DDBJ      :             MFS permease
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  603/915 : Eukaryota  97/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:402 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->214 2gfpA PDBj 1e-17 29.9 %
:RPS:PDB   64->179 2d33D PDBj 5e-06 6.9 %
:RPS:SCOP  46->229 1pv6A  f.38.1.2 * 2e-12 17.0 %
:HMM:SCOP  1->389 1pw4A_ f.38.1.1 * 4.9e-57 23.0 %
:RPS:PFM   46->159 PF00083 * Sugar_tr 2e-09 29.8 %
:HMM:PFM   11->355 PF07690 * MFS_1 2.4e-43 24.5 335/353  
:BLT:SWISS 26->383 BCR_HAEIN 6e-34 28.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87622.2 GT:GENE AAK87622.2 GT:PRODUCT MFS permease GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1834707..1835915 GB:FROM 1834707 GB:TO 1835915 GB:DIRECTION + GB:PRODUCT MFS permease GB:PROTEIN_ID AAK87622.2 GB:DB_XREF GI:159140226 LENGTH 402 SQ:AASEQ MGRTEFIGLAAMLMALNALAIDIMLPGLQEIGASLGVVNENHRQYVISTYLLGFGIAQLLYGPISDRFGRRKPMLVGLAIYIISAIAVVFVPSFTGLLVLRFIQGIGSAATRVITISIVRDIYGGRQMAEVMSLIMMVFMVVPVIAPGTGQIVLFFGDWHLIFAFMAGIAAVVTAWMYFRLPETLHPDDVRPFTARSILGGFKIVLTNRIALCYTLSSTFIFGALFGFINSAEQVYKGIYGLGAWFAAAFAGVALFMAFSSFINARLVGRFGMRKLSHGSLLGFIAITFVWLLVQILGPEPMPFAIFIVFFALAMFQFGWIGSNFNSLAMEPLGHVAGTASSVIGFMGTVGGSLIGAGIGQAFDGTALPMVAGFFAVSIIGLIFVLIGEKGVLFQAHNKPTR GT:EXON 1|1-402:0| BL:SWS:NREP 1 BL:SWS:REP 26->383|BCR_HAEIN|6e-34|28.9|350/398| TM:NTM 12 TM:REGION 10->32| TM:REGION 44->66| TM:REGION 73->95| TM:REGION 101->123| TM:REGION 130->152| TM:REGION 161->183| TM:REGION 204->226| TM:REGION 239->261| TM:REGION 277->299| TM:REGION 302->324| TM:REGION 339->361| TM:REGION 370->392| SEG 7->25|iglaamlmalnalaidiml| SEG 244->259|awfaaafagvalfmaf| BL:PDB:NREP 1 BL:PDB:REP 26->214|2gfpA|1e-17|29.9|184/375| RP:PDB:NREP 1 RP:PDB:REP 64->179|2d33D|5e-06|6.9|116/499| RP:PFM:NREP 1 RP:PFM:REP 46->159|PF00083|2e-09|29.8|114/433|Sugar_tr| HM:PFM:NREP 1 HM:PFM:REP 11->355|PF07690|2.4e-43|24.5|335/353|MFS_1| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| RP:SCP:NREP 1 RP:SCP:REP 46->229|1pv6A|2e-12|17.0|182/417|f.38.1.2| HM:SCP:REP 1->389|1pw4A_|4.9e-57|23.0|382/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2445 OP:NHOMOORG 713 OP:PATTERN --------------1---------------1-1-1---1-----3-1-1-213----11--------- --2-2226555-2241122-2211232222234556235611123442222-2233-2--12212134232----------1------33---1------11-114131---------------------1----132211---22------------------------1------------111-1--14-4666666762667786314424765--1313133333396133333333333333544412221351-11233--332-3111--------------------------------------------------53---------1--22-111-----2--1-442-1--1--1---1----1211112212-23341111311223333233334-11211524332194446546655524111233222233333333333133211-1111111111122-1111-1--1--12222-14213233245554553333333634434245473554--11232343612251132-213521111111---311123-1211-1111-111--11-2111-14--12111-1111-1----------1-----54312-111114444443275443653474----1-1------76233876776666666-76577666667766666669985768566656766666666575546555321544444434444--21452446555-1235111212-11111112444463321222444445582545312227576786651445566676987551211111---------1-11---------------------------------------------------1- --------------15B96FHKFEIEH6525245742222122---946D99KC57855648315-1223-14-43424442235524-875B48165633-2521----512--1-------------------------------------------11--1-----111---------------3-6----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 45.8 SQ:SECSTR #########################HHHHHHHTTccc#TTHHHHHHHHHHHHHHHHHHTTHHHTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEEcTTcTTcccHHHHHHHHHHHHHHHccccccTTTccc####ccTTTccTHHHHHHHHHHH############################################################################################################################################################################################ DISOP:02AL 1-1,189-189,191-191,394-403| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //