[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87635.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->146 1qg3B PDBj 6e-04 31.0 %
:HMM:PFM   21->46 PF09524 * Phg_2220_C 0.00048 42.3 26/74  
:HMM:PFM   70->158 PF07622 * DUF1583 0.00062 23.3 86/400  
:BLT:SWISS 21->146 ITB4_MOUSE 8e-04 31.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87635.2 GT:GENE AAK87635.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1847538..1848056) GB:FROM 1847538 GB:TO 1848056 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87635.2 GB:DB_XREF GI:159140234 LENGTH 172 SQ:AASEQ MLLTAAVLFSHSALAAGPADPVQKVMDITVKNWSGDAENWKYIFDEDMLTSLFSKDFVAQYREASKKPAYEAESGEKGDPFGYDVVTNSQDGCPLQEVSVTPGAVKDGVTDVTAKFKLWACMDEAEIKATVDEVHFDVIEEDGRPVISDIHRVGDEGRDSLREEMANIIKGE GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 21->146|ITB4_MOUSE|8e-04|31.9|113/1818| BL:PDB:NREP 1 BL:PDB:REP 21->146|1qg3B|6e-04|31.0|113/193| HM:PFM:NREP 2 HM:PFM:REP 21->46|PF09524|0.00048|42.3|26/74|Phg_2220_C| HM:PFM:REP 70->158|PF07622|0.00062|23.3|86/400|DUF1583| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 65.7 SQ:SECSTR ####################ccccccEEEEEEETTccGGGcEEEEEccEccccT######TcEEEEEEEEEETTEE##ccccccEEEEcc#####ccccccccccEEEEcccccEEEEccccccccccccEEEEEEEEccTTcccc########################## DISOP:02AL 1-1,64-78,172-173| PSIPRED ccHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccHHEEcHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccccccHHHEEcccHHHHccHHHHHHHEEHEEEccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHccc //