[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87638.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->122 2qntA PDBj 5e-65 100.0 %
:RPS:PDB   1->122 3bt3A PDBj 3e-14 14.8 %
:RPS:SCOP  1->118 2pjsA1  d.32.1.2 * 7e-14 22.9 %
:HMM:SCOP  1->122 2i7rA1 d.32.1.2 * 1.9e-20 29.8 %
:RPS:PFM   10->117 PF00903 * Glyoxalase 4e-07 34.6 %
:HMM:PFM   9->118 PF00903 * Glyoxalase 1.2e-14 21.8 110/128  
:BLT:SWISS 10->122 YRAH_BACSU 6e-09 35.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87638.1 GT:GENE AAK87638.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1850536..1850919) GB:FROM 1850536 GB:TO 1850919 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87638.1 GB:DB_XREF GI:15156990 LENGTH 127 SQ:AASEQ MRFVNPIPFVRDINRSKSFYRDRLGLKILEDFGSFVLFETGFAIHEGRSLEETIWRTSSDAQEAYGRRNMLLYFEHADVDAAFQDIAPHVELIHPLERQAWGQRVFRFYDPDGHAIEVGESLSQSGE GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 10->122|YRAH_BACSU|6e-09|35.1|111/128| BL:PDB:NREP 1 BL:PDB:REP 2->122|2qntA|5e-65|100.0|118/124| RP:PDB:NREP 1 RP:PDB:REP 1->122|3bt3A|3e-14|14.8|122/129| RP:PFM:NREP 1 RP:PFM:REP 10->117|PF00903|4e-07|34.6|104/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 9->118|PF00903|1.2e-14|21.8|110/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->118|2pjsA1|7e-14|22.9|109/111|d.32.1.2| HM:SCP:REP 1->122|2i7rA1|1.9e-20|29.8|114/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 30 OP:NHOMOORG 28 OP:PATTERN ---------------------------------------------11---111--------------- ---------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-1-1311--------------1-----------------------------------------------------------------111-------11------1-------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 99.2 SQ:SECSTR ccccccEEEEccHHHHHHHHHHTTccEEEEEEEcTccEEEEEEEcccTTTTcccccccEEEEEccccccEEEEEEcccHHHHHHHHHHTcccccccEEETTTEEEEEEEcTTccEEEEEEEcGcGG# DISOP:02AL 59-63, 124-127| PSIPRED ccEEEEEEEEccHHHHHHHHHHHHccEEEEcccccEEEcccEEEEEcccHHHHccccccccccccccccEEEEEEEccHHHHHHHHHccccccccccccccccEEEEEEcccccEEEEEcccccccc //