[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87648.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
a.118.8c.66.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->45 3dsuA PDBj 9e-05 14.0 %
:RPS:PDB   16->80 1dceA PDBj 7e-08 10.9 %
:RPS:PDB   52->250 2b25B PDBj 3e-11 11.6 %
:RPS:SCOP  9->65 2ooeA1  a.118.8.7 * 4e-07 22.8 %
:RPS:SCOP  70->255 2avnA1  c.66.1.41 * 4e-09 20.8 %
:HMM:SCOP  6->104 2ff4A2 a.118.8.3 * 0.00012 27.8 %
:HMM:SCOP  56->271 1xvaA_ c.66.1.5 * 1.2e-36 30.7 %
:RPS:PFM   133->205 PF08241 * Methyltransf_11 6e-05 36.6 %
:HMM:PFM   113->206 PF08241 * Methyltransf_11 1.5e-13 42.4 92/95  
:HMM:PFM   16->45 PF00515 * TPR_1 2.2e-09 36.7 30/34  
:BLT:SWISS 1->56 SPY_SOLLC 5e-05 39.3 %
:BLT:SWISS 124->208 UBIG_THICR 1e-05 27.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87648.1 GT:GENE AAK87648.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1863063..1863887 GB:FROM 1863063 GB:TO 1863887 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87648.1 GB:DB_XREF GI:15157001 LENGTH 274 SQ:AASEQ MTKNQKIDEEALAEAYNRALALEKAGDVDAAVKAYEEVLAIDPDDHGGAAVRIAAMGRGEQPSKAPDAYVETLFDQHAEAFEDILVEQLGYAVPMMVRQRLQTLNLGPFKRLLDLGCGTGLTGEALRDMADDITGIDISENMVEIAHEKDLYETLYVAEAEDFLEDNDDEPFDIITATDVLPYLGALEPLFFGAAENLNAGGLLIFSSETLPADIMAGRPYMVGPHQRFAHAETYVRDRLAATGFEVVEVTDINVRMQDGNPTPGHLVIAKLKG GT:EXON 1|1-274:0| BL:SWS:NREP 2 BL:SWS:REP 1->56|SPY_SOLLC|5e-05|39.3|56/931| BL:SWS:REP 124->208|UBIG_THICR|1e-05|27.4|84/241| SEG 112->123|lldlgcgtgltg| RP:PDB:NREP 3 RP:PDB:REP 3->45|3dsuA|9e-05|14.0|43/306| RP:PDB:REP 16->80|1dceA|7e-08|10.9|64/566| RP:PDB:REP 52->250|2b25B|3e-11|11.6|198/239| RP:PFM:NREP 1 RP:PFM:REP 133->205|PF08241|6e-05|36.6|71/96|Methyltransf_11| HM:PFM:NREP 2 HM:PFM:REP 113->206|PF08241|1.5e-13|42.4|92/95|Methyltransf_11| HM:PFM:REP 16->45|PF00515|2.2e-09|36.7|30/34|TPR_1| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 2 RP:SCP:REP 9->65|2ooeA1|4e-07|22.8|57/527|a.118.8.7| RP:SCP:REP 70->255|2avnA1|4e-09|20.8|183/246|c.66.1.41| HM:SCP:REP 6->104|2ff4A2|0.00012|27.8|90/0|a.118.8.3|1/1|TPR-like| HM:SCP:REP 56->271|1xvaA_|1.2e-36|30.7|215/292|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 89 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1-111--111--111111111111-111111-1111-222222222222-------1--------------------2----1----------------------------------------------------------------------1-11-1---11-------1------------1---1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------1-1-------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------111-112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 98.5 SQ:SECSTR #HHHcEEcccccEEEEEcccccTcEEEccccEEcccccccccccTTccccccEEEEEccccTTccTTEEEcccEEEEcccHHHHHccccccccHHHHHHHHHHHTccTTcEEEEEccTTcHHHHHHHHHHcTEEEEEccHHHHHHHHHHHHHHHHTccccccccEEEEEccTTcccEEEEEEccccGGGGHHHHGGGEEEEEEEEEEEHHHHHHHHHEEccccccEEEcccEEEccccccccccEEEEEEEEEcGGccTTccccccEEEEE### DISOP:02AL 1-3, 59-63| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHccEEEEEEccHHHHHHHHHHcccccEEEEHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccccccccEEEcccccccccHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEcccc //