[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87657.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  127/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.50.1
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   129->221 1b11A PDBj 5e-06 23.7 %
:RPS:SCOP  128->221 1nsoA  b.50.1.1 * 1e-06 13.3 %
:HMM:SCOP  117->226 1fmbA_ b.50.1.1 * 9.4e-17 33.7 %
:HMM:PFM   128->221 PF00077 * RVP 7.4e-07 30.7 88/100  
:BLT:SWISS 21->234 YCBV_PSEDE 3e-68 59.6 %
:PROS 138->149|PS00141|ASP_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87657.1 GT:GENE AAK87657.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1871329..1872036 GB:FROM 1871329 GB:TO 1872036 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87657.1 GB:DB_XREF GI:15157012 LENGTH 235 SQ:AASEQ MNRLTIVLLILAVGLGLLLINHDGGRTLGIDNDQFAQALYLVPIAGLLSVGILAGRRGGFGTVIRQLAVWLVIILGLVSLYLYRYDLQSFGDRLLSGLMPGRAVVVTTAGGEQEIVLHKSMSGHFEANVGVNGKTIHMLVDTGASSVVLANADAAEIGIDTGSLRYTVPVMTANGRTAAAPVTLSEIGIGPIMRRNIPALVAQDGQLGQSLLGMSFLSTLGSLQMQTDELRLRDR GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 21->234|YCBV_PSEDE|3e-68|59.6|213/233| PROS 138->149|PS00141|ASP_PROTEASE|PDOC00128| TM:NTM 3 TM:REGION 4->26| TM:REGION 33->54| TM:REGION 63->85| SEG 4->20|ltivllilavglgllli| RP:PDB:NREP 1 RP:PDB:REP 129->221|1b11A|5e-06|23.7|93/113| HM:PFM:NREP 1 HM:PFM:REP 128->221|PF00077|7.4e-07|30.7|88/100|RVP| RP:SCP:NREP 1 RP:SCP:REP 128->221|1nsoA|1e-06|13.3|90/107|b.50.1.1| HM:SCP:REP 117->226|1fmbA_|9.4e-17|33.7|104/104|b.50.1.1|1/1|Acid proteases| OP:NHOMO 157 OP:NHOMOORG 127 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-------2222222122211-11111112-11211312121-222222222211111111111111111----------------111--11111--111111111111111-1-1--1---------------------------------------11-----1-1-111-222------------111-1-------------------------------------------------------------11111---------------------------1--------------------------------------------------------------------------------------------------------1-----------------------------1111111-111111111----------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 39.6 SQ:SECSTR ################################################################################################################################EEETTEEEEEEEcTTccccEEEGGGcccTTcEEEEEEEEEccccEEEEEEEEEEEEEEccTTccccEEEEEEEETTccccccEEcHHHHHHHT############## DISOP:02AL 1-2, 101-114, 234-235| PSIPRED ccHHHHHHHHHHHccEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccEEEEccccEEEEEEEEcccccEEEEEEEccEEEEEEEEcccccEEEcHHHHHHHccEEccccccEEEEEcccEEEEEEEEEEEEEEccEEEEEEEEEEEccccccccEEHHHHHccccEEEEEccEEEEEEc //