[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87670.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  126/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:273 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->266 PF01925 * TauE 7.3e-46 37.4 230/239  
:BLT:SWISS 38->268 Y902_HAEIN 1e-13 28.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87670.1 GT:GENE AAK87670.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1885411..1886232) GB:FROM 1885411 GB:TO 1886232 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87670.1 GB:DB_XREF GI:15157027 LENGTH 273 SQ:AASEQ MPPVSEILVFAAALAAAGVVAGLLAGLFGIGGGAVLVPVFYHVFGLLDVPEAVRMHLSLGTSLAIIVPTSVRSFLTHRQKGAVDIDLLKGWIVAVPLGTILASVVAAYASSVALRLIFAFIALALAFRMIVNRASWQLGSDLPKNPARFLVGTGIGLLSGLMGVGGGVMNNTFMTLYGRTIHQAVATSSGVGVLISLPGLLGYIWAGWGNAGLPPFSTGFINWIAVVLLIPITLLVAPYGVRLAHALSKKQLERAFGVFLVFVAAQFFYSVYG GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 38->268|Y902_HAEIN|1e-13|28.6|231/264| TM:NTM 8 TM:REGION 4->26| TM:REGION 33->55| TM:REGION 83->105| TM:REGION 110->132| TM:REGION 146->168| TM:REGION 185->207| TM:REGION 223->245| TM:REGION 251->273| SEG 7->37|ilvfaaalaaagvvagllaglfgigggavlv| SEG 102->128|asvvaayassvalrlifafialalafr| SEG 154->169|gigllsglmgvgggvm| HM:PFM:NREP 1 HM:PFM:REP 14->266|PF01925|7.3e-46|37.4|230/239|TauE| OP:NHOMO 144 OP:NHOMOORG 131 OP:PATTERN --------------------------------------------1-----1-1--------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------------------1-11-11---1-----11131-1-2122-11---------------1-----------------------------1-----1----------------------------111-12----1----11111111--111-11--11----112--1-1112111111-----1-1-------------------------------------11121----121----1-1---11-11112--112-1--------11------------------------------------11-----------------------------------------------111----1-111---1---11111---111111-111-1111111-11---1-------------2-1-1-----11111----------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 133-146| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHc //