[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87671.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  111/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.65.1
:282 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  146->281 1lbuA2  d.65.1.1 * 7e-13 27.8 %
:RPS:PFM   105->281 PF06904 * Extensin-like_C 1e-33 44.9 %
:HMM:PFM   104->281 PF06904 * Extensin-like_C 6e-58 39.5 177/179  
:PROS 137->162|PS00217|SUGAR_TRANSPORT_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87671.2 GT:GENE AAK87671.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1886631..1887479) GB:FROM 1886631 GB:TO 1887479 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87671.2 GB:DB_XREF GI:159140251 LENGTH 282 SQ:AASEQ MDSMLGVEPVRGLAEEQDADIAEGASAQPVVDGIGTDNPVAVSPPRRQQGASQSRLIPPPPVGSSSRRQPVEEVAMLMPNDPMAGGPMQSNRSMPPGVMPSSEVACRSELRRLGVAFRDVARIADGPTCGIDYPIELSGLASGVAIRPAVKLNCQVTLAFAKWVKFELVPSSRFRYLSGVGRITPMGGYSCRKMNSRSSNPWSEHARGNAIDIGTITLKNGKEIDVRSKSFFAFREKALLKAVRSDSCKYFSTVLGPGSDPNHWNHFHFDLRTRKSGYRHCD GT:EXON 1|1-282:0| PROS 137->162|PS00217|SUGAR_TRANSPORT_2|PDOC00190| RP:PFM:NREP 1 RP:PFM:REP 105->281|PF06904|1e-33|44.9|176/179|Extensin-like_C| HM:PFM:NREP 1 HM:PFM:REP 104->281|PF06904|6e-58|39.5|177/179|Extensin-like_C| RP:SCP:NREP 1 RP:SCP:REP 146->281|1lbuA2|7e-13|27.8|108/130|d.65.1.1| OP:NHOMO 153 OP:NHOMOORG 111 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----122222221222211221222222-22221222211-22211222222232-1-1111111111-------------1-1------------------------------21121--------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------1---1-------------------------------11111---1111111111111111--------------------------------------1----------------------------1111-111111111111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,11-134,197-201,277-277,282-283| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEcccEEEEHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccEEEEEEEEEcccEEEEEEcccccccHHHHHHHHHHHHccccccccccccccHHHHHcEEEccccccccccccc //