[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87732.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->69 PF05622 * HOOK 0.00011 31.1 61/713  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87732.2 GT:GENE AAK87732.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1941259..1941474 GB:FROM 1941259 GB:TO 1941474 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87732.2 GB:DB_XREF GI:159140272 LENGTH 71 SQ:AASEQ MPMGHANMLWNIEKLEQERIDLIEVIAALRHLERVATEDRSSIFEKITAHMVRLSELDAEKQRIHSVLEVG GT:EXON 1|1-71:0| HM:PFM:NREP 1 HM:PFM:REP 8->69|PF05622|0.00011|31.1|61/713|HOOK| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //