[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87738.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->123 PF09917 * DUF2147 1.1e-22 30.2 96/114  
:BLT:SWISS 29->115 C1TM_YEAST 6e-04 28.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87738.1 GT:GENE AAK87738.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1946958..1947335 GB:FROM 1946958 GB:TO 1947335 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87738.1 GB:DB_XREF GI:15157103 LENGTH 125 SQ:AASEQ MKISRLAIVSALLPTLAGLSAAAGEIDGNWARGDGKAKVVIAPCGEKICATNTWIKPGTPKEKTGDRLIMDIKQSEAGSYSGTAFDPQRDKSYKITVTVAGNNMTTKGCIVAGLLCKGISWTRID GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 29->115|C1TM_YEAST|6e-04|28.7|87/975| TM:NTM 1 TM:REGION 4->26| HM:PFM:NREP 1 HM:PFM:REP 28->123|PF09917|1.1e-22|30.2|96/114|DUF2147| OP:NHOMO 31 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-213---1-221---------------------1---221111221--------1-----111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHcccccccccccccEEEcccccEEEEEEEccccEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEcEEcccEEEEEEc //