[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87749.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:35 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->31 PF07365 * Toxin_8 0.00047 47.8 23/66  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87749.1 GT:GENE AAK87749.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1956634..1956741 GB:FROM 1956634 GB:TO 1956741 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87749.1 GB:DB_XREF GI:15157116 LENGTH 35 SQ:AASEQ MISGLSKATAVQSFPSDEAATSELRAKAKHQKTSV GT:EXON 1|1-35:0| HM:PFM:NREP 1 HM:PFM:REP 8->31|PF07365|0.00047|47.8|23/66|Toxin_8| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 20-21, 23-35| PSIPRED cccccccHHHHHcccccHHHHHHHHHHHHHHcccc //