[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87754.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->156 3g0kA PDBj 2e-17 46.9 %
:RPS:PDB   38->153 3ec9A PDBj 2e-15 16.4 %
:RPS:SCOP  32->148 1c7hA  d.17.4.3 * 7e-13 10.3 %
:HMM:SCOP  38->148 1sjwA_ d.17.4.9 * 3.1e-15 29.1 %
:RPS:PFM   46->142 PF07366 * SnoaL 4e-05 29.9 %
:HMM:PFM   42->145 PF07366 * SnoaL 1.7e-13 28.8 104/126  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87754.2 GT:GENE AAK87754.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1961076..1961552) GB:FROM 1961076 GB:TO 1961552 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87754.2 GB:DB_XREF GI:159140282 LENGTH 158 SQ:AASEQ MNFVTRRLAIAALALAPALLAAPVLAETAKRDLAQEETNRKLVIDFYDTVFNKHEVAKGAAVIVDSYKQHNPMVPDGKKPFVDYFTGFFKENPQAKSRIVRSATDGDLVYLHIHSTDKEGARGAAIVDIFRVTDGKITEHWDVIQPVPEKAANNNTMF GT:EXON 1|1-158:0| TM:NTM 1 TM:REGION 8->29| SEG 8->26|laiaalalapallaapvla| BL:PDB:NREP 1 BL:PDB:REP 34->156|3g0kA|2e-17|46.9|113/124| RP:PDB:NREP 1 RP:PDB:REP 38->153|3ec9A|2e-15|16.4|116/125| RP:PFM:NREP 1 RP:PFM:REP 46->142|PF07366|4e-05|29.9|97/126|SnoaL| HM:PFM:NREP 1 HM:PFM:REP 42->145|PF07366|1.7e-13|28.8|104/126|SnoaL| RP:SCP:NREP 1 RP:SCP:REP 32->148|1c7hA|7e-13|10.3|116/123|d.17.4.3| HM:SCP:REP 38->148|1sjwA_|3.1e-15|29.1|110/0|d.17.4.9|1/1|NTF2-like| OP:NHOMO 84 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------1-----------11----------------------------------------------------------------------------------------------------------------------------------------------------1-1----11---------1-----------------------------------------------------------------------11111111111-------------111---111-------------------------------------------------1----1-----------11---------------------1----------111--1--1---1-------------1-----------------------------------------------3---111--122222---------------2-------------1------1-------1-------------------------------1-----------------1--------------------------------1-------------------11--------------------------------------------------------1---------------------------------------------------------1111-1-----2---------------------------------------------1------------11111------------------------------------------------------------------ --------------------11------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 81.6 SQ:SECSTR ###########################HHHHccccHHcHHHHHHHHHHHHHTTcHHHHTEEEEEEEEEcTcTTcEEHHHHHHHTHHHHHHHEEEEEEEEEEEEEETTEEEEEEEEEEEETTTccEEEEEEEEETTEEEEEEEEEcHHHHHHHcccc## DISOP:02AL 1-3,152-159| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcHHHcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHccccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEccccccccccEEEEEEEEEEccEEEEEEccccccccccccccccc //