[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87755.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  238/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:203 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->203 3dhnA PDBj 5e-39 47.2 %
:RPS:PDB   1->100 3c1oA PDBj 3e-10 24.0 %
:RPS:SCOP  1->202 1hdoA  c.2.1.2 * 8e-18 18.0 %
:HMM:SCOP  1->205 1hdoA_ c.2.1.2 * 3.4e-35 38.4 %
:RPS:PFM   4->123 PF05368 * NmrA 2e-10 40.2 %
:HMM:PFM   4->94 PF05368 * NmrA 2.2e-14 33.3 90/233  
:BLT:SWISS 15->201 YWNB_BACSU 3e-34 46.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87755.1 GT:GENE AAK87755.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1961564..1962175) GB:FROM 1961564 GB:TO 1962175 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87755.1 GB:DB_XREF GI:15157123 LENGTH 203 SQ:AASEQ MAKIALIGASGNAGSRILKELSDRGHQVTAIARNPEKIAALPNVVAKKGDVFDQAALSELLKGHDAVISSVHFTASDPATLIEAVRASGVQRYLVVGGAGSLEIAPGQRVVDLPDFPAAYKAEATKGAEFLDKLKQEKQLDWTFLSPSAEFVPGERTGKFRIGKDNLLSNEQGSRISFEDYAIALADEIEKPQHSRQRFTVGY GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 15->201|YWNB_BACSU|3e-34|46.2|184/213| BL:PDB:NREP 1 BL:PDB:REP 3->203|3dhnA|5e-39|47.2|197/210| RP:PDB:NREP 1 RP:PDB:REP 1->100|3c1oA|3e-10|24.0|100/314| RP:PFM:NREP 1 RP:PFM:REP 4->123|PF05368|2e-10|40.2|117/234|NmrA| HM:PFM:NREP 1 HM:PFM:REP 4->94|PF05368|2.2e-14|33.3|90/233|NmrA| RP:SCP:NREP 1 RP:SCP:REP 1->202|1hdoA|8e-18|18.0|189/205|c.2.1.2| HM:SCP:REP 1->205|1hdoA_|3.4e-35|38.4|190/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 299 OP:NHOMOORG 251 OP:PATTERN -----------------------------1-1------------------------------------ --1-31-1------1---------------------211--314---1----1-11-1--111-1-22--1------1---1------111----------1--12-1--------------------------------------11-----------------------------------11--------22222213312322231-2111321---1-2111111222---------------1---11-1-22--1--111122112-11111----------11111111111-------------111---111------1111111-1--------------1-----------------------------------121------------------1------1---1--111--1---1111----111-------------------1--1-------------------------------11---11-11111111111111111111111111111----1---111-1-2--1--11-2--------------------1---------------------------11-1-1----1--------------111---1-1---211-11-111111-11-----------------11--1----------------------------------1-------------------1------------------------------------------1-----------------1-----1111121111111------------------11111--11111------------------------------1-1------------------1-----------------1- ------------------------------------1-----------11--11-------------------------------------------------2-------1---------------------------------------------------1-1-----------------------1----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 100.0 SQ:SECSTR cccEEEETTTcTTHHHHHHHHHHTTccEEEEEccccTTccHTTcEEEEccTTcHHHHHHHHTTccEEEEcccGGGcGGGHHHHHHHHHcccEEEcccccccGGGHHHHHEEEcHHHHHHHEEccHHHHHHHHHHHHHHTccGGGccccHHEEEccccTTcEEEEEcccGGGEcccccHHHHHHHHHHHHHHHHHHHHTTEEEc PSIPRED ccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHcccccccEEEEcccccHHHHHHHHccccEEEEccccccccHHHHHHHHHHccccEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccEEcccccccEEEEcccccEEcccccEEEHHHHHHHHHHHHcccHHcccEEEccc //