[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87759.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->143 3htrA PDBj 3e-05 33.3 %
:RPS:PDB   61->148 3bl4B PDBj 4e-10 12.0 %
:RPS:SCOP  63->102 1pm3A  b.41.1.2 * 6e-04 22.5 %
:HMM:SCOP  59->132 1pm3A_ b.41.1.2 * 2.1e-10 28.4 %
:RPS:PFM   63->113 PF05239 * PRC 6e-07 51.0 %
:HMM:PFM   62->137 PF05239 * PRC 6e-15 37.0 73/79  
:HMM:PFM   4->88 PF10507 * DUF2453 0.00047 20.5 83/111  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87759.2 GT:GENE AAK87759.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1967456..1967911 GB:FROM 1967456 GB:TO 1967911 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87759.2 GB:DB_XREF GI:159140284 LENGTH 151 SQ:AASEQ MKINVIALAAAAALTSSVAFAQTATTAPAAGADATLSGPGITMGTKASGPLKFVNVQKTDLTASQLDGMDIYNAQNENIGEIEDVVIGDGKSVIGLVASVGGFLGIDKSYVVLDPASVAVHNDNGTWKAYVDTTKDALQNAPKLDYDKLDD GT:EXON 1|1-151:0| TM:NTM 1 TM:REGION 1->23| SEG 7->14|alaaaaal| SEG 19->35|afaqtattapaagadat| BL:PDB:NREP 1 BL:PDB:REP 63->143|3htrA|3e-05|33.3|78/96| RP:PDB:NREP 1 RP:PDB:REP 61->148|3bl4B|4e-10|12.0|83/109| RP:PFM:NREP 1 RP:PFM:REP 63->113|PF05239|6e-07|51.0|51/77|PRC| HM:PFM:NREP 2 HM:PFM:REP 62->137|PF05239|6e-15|37.0|73/79|PRC| HM:PFM:REP 4->88|PF10507|0.00047|20.5|83/111|DUF2453| RP:SCP:NREP 1 RP:SCP:REP 63->102|1pm3A|6e-04|22.5|40/69|b.41.1.2| HM:SCP:REP 59->132|1pm3A_|2.1e-10|28.4|74/78|b.41.1.2|1/1|PRC-barrel domain| OP:NHOMO 22 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111-------------------2-1-22-----11--------111----1-----------------------------------------------------------------------------1---------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 58.3 SQ:SECSTR ############################################################EEEEccccccccHHHHHHHHHHHHHHTccccEEEcccHHHHHHTTcccHHHHHHcccccccEEEEcccGGGHHHHHHHHHHTTccccE### DISOP:02AL 1-2,28-50,145-152| PSIPRED cHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHccccccccccccccccccEEccccEEccccccccEEEEEEEcccccEEEEEEEccccccccccEEEEcHHHEEEEEccccEEEEEcccHHHHHHcccccHHcccc //