[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87767.1
DDBJ      :             ABC transporter, membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  523/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:564 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->245 2onkC PDBj 6e-17 31.3 %
:BLT:PDB   356->506 2r6gG PDBj 9e-10 30.6 %
:RPS:PDB   168->208 3dhwA PDBj 1e-11 36.6 %
:RPS:PDB   452->484 3dhwA PDBj 3e-06 30.3 %
:RPS:SCOP  46->274 2r6gG1  f.58.1.1 * 2e-20 15.6 %
:RPS:SCOP  353->520 2r6gG1  f.58.1.1 * 8e-16 24.6 %
:RPS:PFM   91->223 PF00528 * BPD_transp_1 1e-10 40.0 %
:RPS:PFM   380->506 PF00528 * BPD_transp_1 9e-07 34.3 %
:HMM:PFM   91->263 PF00528 * BPD_transp_1 2.5e-18 25.5 153/185  
:HMM:PFM   373->559 PF00528 * BPD_transp_1 1.1e-17 25.6 176/185  
:BLT:SWISS 47->519 FBPB1_HAEIN 2e-22 25.7 %
:TM
:REPEAT 2|59->237|353->520
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87767.1 GT:GENE AAK87767.1 GT:PRODUCT ABC transporter, membrane spanning protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1974364..1976058) GB:FROM 1974364 GB:TO 1976058 GB:DIRECTION - GB:PRODUCT ABC transporter, membrane spanning protein GB:PROTEIN_ID AAK87767.1 GB:DB_XREF GI:15157137 LENGTH 564 SQ:AASEQ MTRSKAYGSSQPRWLFPFVVSVVFALSALPLGRLAYTGIVSSLNGDIWRLLADPALWDAAQNTLSTSFFGMLISLAIGGAFALSLTLCDIRGKSILSFLFMLPMMIPPQVTALSWIGMTGPSSTLLKAIGLAPAMGSPQPLYSIAGIALLLGVQHAPLVYLSLRAGLLALPQDGIEAAKLSGASPRRVLFDIILPLSTPGLIAGAAISFVSNVGNFGIPAILGIPGSIFTLPTLIYSRFASFGTSTFGDIAILSTMIAIISVAGLALQERAMKGRDYRIIGLSGKAATFGLGRWRVPAELALWLVLLFMLVAPLTALVASSLAPAYGVPLSLKTATLHAYEELLYRQSVTRTAFRNSLFLATATSLCLLAVTVLTAYFLVRGKSRFMFLLSALVDIPYALPGVVISVSFVLLFAAPIPLLGVTLYGTIWIILLAYFSSFFAVSLKPMVSAFLQFDPSLEEAARLSGAGFWRRLKDIILPLVGPAAGASVILVFLIACNELTVSALLWSAGTQTLGVLIYNLDDSGSFDLASALSVLVVIMVIILMLLLEILGRYLPKGVVPWRN GT:EXON 1|1-564:0| BL:SWS:NREP 1 BL:SWS:REP 47->519|FBPB1_HAEIN|2e-22|25.7|459/632| TM:NTM 13 TM:REGION 11->33| TM:REGION 66->88| TM:REGION 95->117| TM:REGION 144->166| TM:REGION 188->210| TM:REGION 218->239| TM:REGION 247->269| TM:REGION 302->324| TM:REGION 356->378| TM:REGION 394->416| TM:REGION 432->454| TM:REGION 480->502| TM:REGION 529->551| NREPEAT 1 REPEAT 2|59->237|353->520| SEG 296->314|vpaelalwlvllfmlvapl| SEG 529->551|lasalsvlvvimviilmllleil| BL:PDB:NREP 2 BL:PDB:REP 52->245|2onkC|6e-17|31.3|182/252| BL:PDB:REP 356->506|2r6gG|9e-10|30.6|147/284| RP:PDB:NREP 2 RP:PDB:REP 168->208|3dhwA|1e-11|36.6|41/203| RP:PDB:REP 452->484|3dhwA|3e-06|30.3|33/203| RP:PFM:NREP 2 RP:PFM:REP 91->223|PF00528|1e-10|40.0|125/195|BPD_transp_1| RP:PFM:REP 380->506|PF00528|9e-07|34.3|124/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 91->263|PF00528|2.5e-18|25.5|153/185|BPD_transp_1| HM:PFM:REP 373->559|PF00528|1.1e-17|25.6|176/185|BPD_transp_1| GO:PFM:NREP 6 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 2 RP:SCP:REP 46->274|2r6gG1|2e-20|15.6|218/284|f.58.1.1| RP:SCP:REP 353->520|2r6gG1|8e-16|24.6|167/284|f.58.1.1| OP:NHOMO 1870 OP:NHOMOORG 559 OP:PATTERN 11--2--------1-13--1---1233113111--11-12211---1---2---12-2211------- -11131-1334-1-1--22-2---2222222111111435---2241--1117-2-----1-----112-1----21-122-4---------1------------1--1------------------1-1-21--12--66--152-111---2111---1-11-212322111--1-1----12--1-1-312435355554545554623312555-3412-2------981--------------1---1-----------11------------------------111111---1------------------------12133333233-4--4221221223-15-22111111221--1---12----2331-----2-799423223124565466276C-33322333AF2-GCC5ABEJEEEF74---24E6279844---------111-125--1--------------------------------57533788989345548897666647D683242--333211222364582321---44--322131-211121511131--4111-2-1---12-----2-12----------------------1-1--223-311111133333122444335223231---211------25423434444443444-4444332423444334434767D91234455545554454554733322233-488778888888---2----------12281227541-1-12114------222232646367BA9889729991---------2333444443-3321111111111----1112221111--------1----------------------------33--36333--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------1------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 379 STR:RPRED 67.2 SQ:SECSTR ##############################################cHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHTHHHHHcTTcTTTTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHccHHHHHHTTccccccHHHHHHHHHHHHcGGTTHHHHHHHHHHHHHHHHHHHHTTTcccc#################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcHHHHHHHHHTTccccccHHHHHHHHHHHHcTTccTTcHHHHcccHHHHTTTTHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHH########################################################## DISOP:02AL 273-294, 563-564| PSIPRED ccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //