[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87768.1
DDBJ      :             ABC transporter, substrate binding protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  229/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:327 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->79 3c9hB PDBj 2e-04 34.5 %
:BLT:PDB   50->322 1y4tD PDBj 1e-09 24.1 %
:RPS:PDB   6->316 3c9hB PDBj 1e-25 14.8 %
:RPS:SCOP  25->317 1d9vA  c.94.1.1 * 8e-47 20.8 %
:HMM:SCOP  21->322 1xvxA_ c.94.1.1 * 8.3e-72 36.8 %
:RPS:PFM   37->270 PF01547 * SBP_bac_1 3e-06 32.0 %
:HMM:PFM   38->272 PF01547 * SBP_bac_1 2.3e-24 27.8 234/314  
:BLT:SWISS 26->272 Y131_HAEIN 5e-16 30.7 %
:BLT:SWISS 247->321 FBPA_HAEIN 4e-06 31.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87768.1 GT:GENE AAK87768.1 GT:PRODUCT ABC transporter, substrate binding protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1976068..1977051) GB:FROM 1976068 GB:TO 1977051 GB:DIRECTION - GB:PRODUCT ABC transporter, substrate binding protein GB:PROTEIN_ID AAK87768.1 GB:DB_XREF GI:15157138 LENGTH 327 SQ:AASEQ MKTLLSAFTAIVSLGFIATAANAADLVLYTSQPNEDAQATVDGFKAANPGIEVEWVRDGTPKIMAKLMAEINAGNPVADVLLIADTVTLERMKQAGQLLAHKSAEAKNIDASLYDADGFYYSTKLITTGIMYNTAAAMKPTSWKDLAKAEAKGLVTMPSPLTSGAALIHAQTLAAANGLGWDYYRQLKANEAIAGGGNGAVLKSVASGEKAYGVVVDYMPIREKAKGAPVEFVFPEEGVSAVTEPVAIIKGTKHEEAAKKFVDYVLSEKGQQGFVKLGYIPVRADAGMPEGFPARDKIKVLPLSAADALKNSEQDLKTFSDIFGSKG GT:EXON 1|1-327:0| BL:SWS:NREP 2 BL:SWS:REP 26->272|Y131_HAEIN|5e-16|30.7|241/346| BL:SWS:REP 247->321|FBPA_HAEIN|4e-06|31.1|74/332| SEG 165->176|aalihaqtlaaa| SEG 189->200|aneaiagggnga| BL:PDB:NREP 2 BL:PDB:REP 22->79|3c9hB|2e-04|34.5|58/339| BL:PDB:REP 50->322|1y4tD|1e-09|24.1|270/316| RP:PDB:NREP 1 RP:PDB:REP 6->316|3c9hB|1e-25|14.8|310/339| RP:PFM:NREP 1 RP:PFM:REP 37->270|PF01547|3e-06|32.0|231/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 38->272|PF01547|2.3e-24|27.8|234/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 25->317|1d9vA|8e-47|20.8|288/309|c.94.1.1| HM:SCP:REP 21->322|1xvxA_|8.3e-72|36.8|296/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 380 OP:NHOMOORG 239 OP:PATTERN ----------------2--------------------1111--------------1-1---------- ----1--1111---------------------1---1-12---1---------11-----------1---1--------1-------------------------------------------------------------------------1----------1--------------------------1--3333333313333332---1-333----1--------22---------------1---------------11-------------1111111---1-----1----1----1----------------------1111111-11-3--1---1211-3---------2---------2-------------1------2-----11111111112------1--11--244-231133431-----14-1--22----------------1-----------------------------------353421112211111122111111112113231--2211-2--3-1-3111--1--11-----------2-----------1--1-------1------1--2---------------------------2---------1--------------------------------1-2--2--11--------1-----1---1--------11123111-1--------------1---------1--------------------------1-1222443--1-1122511111-----23----2112-1111-111----------1--12222211111-----------------6--------------1---------------------------11----------- ---------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------1-------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 319 STR:RPRED 97.6 SQ:SECSTR ####cccccEEEEEccTTccTTcEEEEEEEcccHHHHHHHHHHHHHHcTTEEEEEEEccHHHHHHHHHHHHHTTcccccEEEEccHHHHHHHHHHTTcEEccccTTGGGccGGGEETTTEEEcccEEEEEEEEGGGcccHHHHHHHTHHHHTTcEEEEcTTTcHHHHHHHHHHHHHcTTHHHHHHHHHHTTcEEEccHHHHHHHHHTTcccEEEEEEHHHHHHHTTcTTEEEEcccccEEEEccEEEEETTcccHHHHHHHHHHHHcHHHHHHHHHcccccccTTccccccHHHHHHHHGGGEEEcccTTGGGGccHHHHHTH#### DISOP:02AL 327-328| PSIPRED cHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccEEEcccHHHHHHHHHccccccccHHHHHHccHHHccccccEEEEEEEEEEEEEEcccccccccHHHHHcHHHccEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHcccEEEccHHHHHHHHHcccccEEEEccHHHHHHHHccccEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccc //