[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87772.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.306.1
:84 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->83 2a6qA PDBj 8e-15 41.0 %
:RPS:PDB   4->84 3d55B PDBj 6e-15 27.5 %
:RPS:SCOP  1->83 2a6qA1  d.306.1.1 * 2e-14 41.0 %
:HMM:SCOP  1->83 2a6qA1 d.306.1.1 * 1.3e-20 42.2 %
:RPS:PFM   4->55 PF02604 * PhdYeFM 5e-05 40.4 %
:HMM:PFM   1->74 PF02604 * PhdYeFM 8.3e-24 39.2 74/75  
:BLT:SWISS 1->83 YEFM_SHIFL 3e-14 41.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87772.2 GT:GENE AAK87772.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1979599..1979853) GB:FROM 1979599 GB:TO 1979853 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87772.2 GB:DB_XREF GI:159140286 LENGTH 84 SQ:AASEQ MANVRFTEFRQNFATHFDRVLETRAPLLVTRQGKEAVVVLAEGEYESMQETLHLLSNPANASRLRASMGELERGDTIERDPTEE GT:EXON 1|1-84:0| BL:SWS:NREP 1 BL:SWS:REP 1->83|YEFM_SHIFL|3e-14|41.0|83/90| BL:PDB:NREP 1 BL:PDB:REP 1->83|2a6qA|8e-15|41.0|83/86| RP:PDB:NREP 1 RP:PDB:REP 4->84|3d55B|6e-15|27.5|80/84| RP:PFM:NREP 1 RP:PFM:REP 4->55|PF02604|5e-05|40.4|52/70|PhdYeFM| HM:PFM:NREP 1 HM:PFM:REP 1->74|PF02604|8.3e-24|39.2|74/75|PhdYeFM| RP:SCP:NREP 1 RP:SCP:REP 1->83|2a6qA1|2e-14|41.0|83/83|d.306.1.1| HM:SCP:REP 1->83|2a6qA1|1.3e-20|42.2|83/0|d.306.1.1|1/1|YefM-like| OP:NHOMO 77 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- -----1--------------------------------11-1-----1-------------1---------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------1----1--------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1------111-1------1---1----1-------------------1--------------------11-------------------111-1----------------1-1----------------------1-----------------1---1---------1--1-1----------------------------------------------1------1----------------------21-------------1--1111111---11-1-1-1-1---1--1---1--1------------------11-1111----------------1-11-11--------3-11----------------1-------------11-1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 100.0 SQ:SECSTR cEEEEHHHHHHTHHHHHHHHHHTcccEEEEETTEEEEEccHHHHHHHHHHHHHHTTcTTHHHHHHHHHHHHHHcHHHHHHHHHc DISOP:02AL 1-1,74-75,78-85| PSIPRED cccEEHHHHHHHHHHHHHHHHHccccEEEEccccccEEEEEHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccccc //