[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87781.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->160 1xfsA PDBj 3e-23 43.4 %
:RPS:PDB   13->160 1e09A PDBj 9e-15 8.5 %
:RPS:SCOP  11->155 1z94A1  d.129.3.5 * 1e-18 22.2 %
:HMM:SCOP  6->161 2gkcA1 d.129.3.5 * 3.8e-29 32.4 %
:RPS:PFM   19->154 PF08327 * AHSA1 2e-06 32.0 %
:HMM:PFM   18->155 PF08327 * AHSA1 1.6e-25 27.3 121/123  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87781.1 GT:GENE AAK87781.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1988551..1989033) GB:FROM 1988551 GB:TO 1989033 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87781.1 GB:DB_XREF GI:15157152 LENGTH 160 SQ:AASEQ MTETFNPDLDLKISRIIKAPRRLVWNAWTDKTSLEQWWVPHPGQCRVDKMELHPGGAFETRYSEDGREFGQHVSGCFLAVDHEQRLIFTDALTAGFRPSAQPFLTAVMTFRDHPDGMEYEAYAMHNNLADRDRHAEMGFFDGWNTVAEQLAQLVEKQAAH GT:EXON 1|1-160:0| BL:PDB:NREP 1 BL:PDB:REP 8->160|1xfsA|3e-23|43.4|143/149| RP:PDB:NREP 1 RP:PDB:REP 13->160|1e09A|9e-15|8.5|142/159| RP:PFM:NREP 1 RP:PFM:REP 19->154|PF08327|2e-06|32.0|122/124|AHSA1| HM:PFM:NREP 1 HM:PFM:REP 18->155|PF08327|1.6e-25|27.3|121/123|AHSA1| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF08327|IPR013538| RP:SCP:NREP 1 RP:SCP:REP 11->155|1z94A1|1e-18|22.2|135/140|d.129.3.5| HM:SCP:REP 6->161|2gkcA1|3.8e-29|32.4|148/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 78 OP:NHOMOORG 72 OP:PATTERN -------------------------------------------------------------------- --------------------------------------11-----------------------------------------------------------------1-1--------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------2--111-------------------------------11-11-1-211-121-11222111--11--11------------------------------------------------------11---1-1-111111-----11--------1--111-----------1-1-------------------1-----1---------------------------------------------------------------1------1111----------------------------------------------------------------111--------------------------------------------------------------------------------------------11-1-1111----------------------------1-------------------1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 96.9 SQ:SECSTR #####TTccEccEEEEEcccHHHHHHHHTTHHHHHHHcTTTEEEEEEEEccccTTcEEEEEEccccccEEEEEEEEEEEEETTTTEEEEEEcccTTTGGGEEEEEEEEEEcccTTcEEEEcEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-4, 158-160| PSIPRED cccccccccEEEEEEEEcccHHHHHHHHccHHHHHHHccccccEEEEEEEEcccccEEEEEEcccccccccEEEEEEEEEEcccEEEEEEccccccccccccEEEEEEEEEEcccccEEEEEEEEccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccc //