[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87782.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  160/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->102 3f6oA PDBj 6e-30 57.7 %
:RPS:PDB   22->116 1bibA PDBj 1e-11 15.8 %
:RPS:SCOP  7->84 1r1uA  a.4.5.5 * 2e-12 20.5 %
:HMM:SCOP  9->116 2p4wA1 a.4.5.64 * 4.4e-21 23.1 %
:RPS:PFM   22->66 PF01022 * HTH_5 1e-05 37.8 %
:HMM:PFM   22->66 PF01022 * HTH_5 2.8e-06 35.6 45/47  
:BLT:SWISS 13->79 SDPR_BACSU 2e-09 34.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87782.1 GT:GENE AAK87782.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1989030..1989404) GB:FROM 1989030 GB:TO 1989404 GB:DIRECTION - GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID AAK87782.1 GB:DB_XREF GI:15157153 LENGTH 124 SQ:AASEQ MIVSFMENYSDALNDIFQSLADPTRRAVILRLGGGEASIGTLAEPFAMALPSFMKHIRQLEEAGLIVTRKQGRVRFCSLEKQRFSMLDGWLSQQRAVWEGRTDRLEQFVMAQQDRMSSKGENDQ GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 13->79|SDPR_BACSU|2e-09|34.3|67/90| BL:PDB:NREP 1 BL:PDB:REP 6->102|3f6oA|6e-30|57.7|97/97| RP:PDB:NREP 1 RP:PDB:REP 22->116|1bibA|1e-11|15.8|95/294| RP:PFM:NREP 1 RP:PFM:REP 22->66|PF01022|1e-05|37.8|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 22->66|PF01022|2.8e-06|35.6|45/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 7->84|1r1uA|2e-12|20.5|78/94|a.4.5.5| HM:SCP:REP 9->116|2p4wA1|4.4e-21|23.1|108/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 327 OP:NHOMOORG 160 OP:PATTERN -------------------------------------------------------------------- 135-3---------1------1--12------43334275-1-11511---1322--3--411-2-3-----------------------------1----2--1215-4----------------------------------1-1-------------------1--1-------------1----------11111111-111111--11--111---1---------22-------------------------------------------------------------------------------------------------------------------------1-11-------1-------5--5113-----124211-1---------------1---1-----775-344-54165444--2231521111111-----------------------------------------------1121-2222122221-----221-------41-1212--112-----1-1-1--1--------------------1-----------------------323236-------------------------------------------------------------------------------------------------------------------------------------2------------------------------------1----------------------------1-----------------------------------------11----------------331111-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 90.3 SQ:SECSTR #####EcEEEEccHHHHHHcccHHHHHHHHHHTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccEEEccEEccHHHHHHHHGGc####### DISOP:02AL 6-7, 110-124| PSIPRED cccccHHHcHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHccHHHHcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //