[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87812.2
DDBJ      :             ABC transporter, substrate binding protein (glycine betaine)
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  213/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:308 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->308 2regA PDBj 2e-80 51.0 %
:RPS:PDB   25->132,138->252 3chgA PDBj 4e-15 29.7 %
:RPS:SCOP  26->289 1r9lA  c.94.1.1 * 1e-36 19.7 %
:HMM:SCOP  19->295 1r9lA_ c.94.1.1 * 1.9e-74 37.7 %
:RPS:PFM   28->278 PF04069 * OpuAC 3e-25 33.5 %
:HMM:PFM   27->277 PF04069 * OpuAC 4.1e-54 26.0 246/257  
:BLT:SWISS 20->149 ORF1_CHRSD 4e-31 43.1 %
:BLT:SWISS 134->295 OPUAC_BACSU 1e-15 30.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87812.2 GT:GENE AAK87812.2 GT:PRODUCT ABC transporter, substrate binding protein (glycine betaine) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2024037..2024963 GB:FROM 2024037 GB:TO 2024963 GB:DIRECTION + GB:PRODUCT ABC transporter, substrate binding protein (glycine betaine) GB:PROTEIN_ID AAK87812.2 GB:DB_XREF GI:159140306 LENGTH 308 SQ:AASEQ MKVVSAAALVLAGESPAFAADADACKMVRMAEPGWNDLAFTTGIAMTLLKSLHYQPQSQLLGIDVIYTSLKSKDLDVFMGYWDPAMVNYYKPYKEDGSVEKVRTNLVGAKYTFAVPTYVWEAGVKDFSDLQKFADKFDRKLYGIEPGSNQLMLDAVKDPALGLKDWEVVESSEQGMLSQVARFNRNKTFIVFQGWAPHPMNAKFDIKYLTGGDKFYGPDFGAATVDTQVRRGYLQECPNVAKLLQNLEFDVEFENKGMDLIMNGGLSPEDAAAQAIKAEPHRLETWLKDVFALDGQNGLATVKAALGL GT:EXON 1|1-308:0| BL:SWS:NREP 2 BL:SWS:REP 20->149|ORF1_CHRSD|4e-31|43.1|130/155| BL:SWS:REP 134->295|OPUAC_BACSU|1e-15|30.1|156/293| BL:PDB:NREP 1 BL:PDB:REP 21->308|2regA|2e-80|51.0|288/290| RP:PDB:NREP 1 RP:PDB:REP 25->132,138->252|3chgA|4e-15|29.7|216/258| RP:PFM:NREP 1 RP:PFM:REP 28->278|PF04069|3e-25|33.5|248/256|OpuAC| HM:PFM:NREP 1 HM:PFM:REP 27->277|PF04069|4.1e-54|26.0|246/257|OpuAC| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF04069|IPR007210| GO:PFM GO:0005488|"GO:binding"|PF04069|IPR007210| GO:PFM GO:0006810|"GO:transport"|PF04069|IPR007210| RP:SCP:NREP 1 RP:SCP:REP 26->289|1r9lA|1e-36|19.7|264/310|c.94.1.1| HM:SCP:REP 19->295|1r9lA_|1.9e-74|37.7|276/309|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 420 OP:NHOMOORG 225 OP:PATTERN --------------------------------------11111--11--1111--------------- -----2---------------------------------------11-------------1--1-211111-----------2-----1111-2--------------1----------------------------------------------------1----------1-----1--------------11111111111111112-1111111---23--21111121------------------1-1----1---------111--11-1111111111-11-----------11111111111111--------1-11--------------11-----1--------1112---9----------------------------------22222221224-11-11211-1-12442221322221-----131111-----------2---1-------------------------------------------4445453444344454444-4844-1------1----------3-------------------------1-8241-1111--------------1----------------------------------1-----1-----------------------11---------------------------------------------------------------------------------------------------------171---------------------------4444455554544-334-------------1-----11111------------------------111-1111----------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 93.5 SQ:SECSTR ####################cccGccEEEEEEcccHHHHHHHHHHHHHHTTTTcEEEEEEccTTHHHHHHHTTcccEEEEEEEcGGGHHHHHTHTTTcEEEEEEEEEEEcEEEEEETTcEcTTcccGGGGGcGHHHHcccEEcccTTcHHHHHHHHHHHHTTcTTccEEcccHHHHHHHHHHHHHTTccccEEEEcccTHHHHccEEEcccTTcTTcccEEEEEEEEEEETTHHHHcHHHHHHHTTccccHHHHHHHHHHHHTTccHHHHHHHHHTTcHHHHHHHTTTTcccTTcccHHHHHHHHTTc DISOP:02AL 261-261| PSIPRED cHHHHHHHHHHHHHcccccccccccccEEEEEccccHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEEcccccEEEEEEEHHHHHcccccHHHHHHHHHHcccEEEccccccHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEcccHHHccccEEEEccccccccccccHHHHHEEccHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcc //