[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87814.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:RPS:PFM   4->141 PF04657 * DUF606 4e-06 32.4 %
:HMM:PFM   5->143 PF04657 * DUF606 1.1e-33 36.3 135/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87814.2 GT:GENE AAK87814.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2025940..2026398 GB:FROM 2025940 GB:TO 2026398 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87814.2 GB:DB_XREF GI:159140308 LENGTH 152 SQ:AASEQ MNPLHLAAAFASGCLLTLMVHFNGQLAHYGNALFSSWTAHGTGTVAALIYLAIMRPKKDAAAPAKPNAPLWAYCGGVVGAAIVILTSTAVNSPLALSGTIALGLGGQVIFSLLADLFGLFGLPKRRPDVQDMVAVCLILCGSALIILVGRAA GT:EXON 1|1-152:0| TM:NTM 5 TM:REGION 6->28| TM:REGION 34->55| TM:REGION 71->93| TM:REGION 99->121| TM:REGION 129->150| SEG 56->69|pkkdaaapakpnap| RP:PFM:NREP 1 RP:PFM:REP 4->141|PF04657|4e-06|32.4|136/139|DUF606| HM:PFM:NREP 1 HM:PFM:REP 5->143|PF04657|1.1e-33|36.3|135/138|DUF606| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11-111----------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------1-------------------------------------------------------------11-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcc //