[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87818.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->50 PF09932 * DUF2164 1e-05 42.9 %
:HMM:PFM   2->75 PF09932 * DUF2164 6.3e-22 39.2 74/76  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87818.2 GT:GENE AAK87818.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2029228..2029464) GB:FROM 2029228 GB:TO 2029464 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87818.2 GB:DB_XREF GI:159140310 LENGTH 78 SQ:AASEQ MLEKQEKAALATRIRDYLTRETETEIGLLQAEIFVDFLADEMGYVFYNQGLRDAHAAILRRLDDAAADIDVLEKPKLR GT:EXON 1|1-78:0| SEG 51->70|lrdahaailrrlddaaadid| RP:PFM:NREP 1 RP:PFM:REP 2->50|PF09932|1e-05|42.9|49/76|DUF2164| HM:PFM:NREP 1 HM:PFM:REP 2->75|PF09932|6.3e-22|39.2|74/76|DUF2164| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,78-79| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //