[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87821.1
DDBJ      :             aminopeptidase P
Swiss-Prot:             

Homologs  Archaea  47/68 : Bacteria  710/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
b.19.1c.55.2d.127.1
:613 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->609 3ctzA PDBj 6e-99 39.9 %
:RPS:PDB   11->609 3ctzA PDBj e-101 34.5 %
:RPS:SCOP  15->139 1chmA1  c.55.2.1 * 3e-16 15.4 %
:RPS:SCOP  199->264 1flcA1  b.19.1.3 * 6e-16 7.7 %
:RPS:SCOP  314->567 1chmA2  d.127.1.1 * 3e-42 18.3 %
:HMM:SCOP  21->90 1pv9A1 c.55.2.1 * 1.4e-07 39.7 %
:HMM:SCOP  180->311 1chmA1 c.55.2.1 * 3.2e-06 22.8 %
:HMM:SCOP  315->575 2bwvA2 d.127.1.1 * 5.9e-57 40.8 %
:RPS:PFM   17->137 PF01321 * Creatinase_N 9e-12 43.1 %
:RPS:PFM   182->312 PF01321 * Creatinase_N 1e-06 28.4 %
:RPS:PFM   376->536 PF00557 * Peptidase_M24 7e-25 44.8 %
:HMM:PFM   325->538 PF00557 * Peptidase_M24 1.7e-44 40.5 195/203  
:HMM:PFM   17->145 PF01321 * Creatinase_N 7.9e-22 36.0 114/131  
:HMM:PFM   183->296 PF01321 * Creatinase_N 1.1e-08 25.9 108/131  
:BLT:SWISS 30->611 XPP1_RAT e-103 41.2 %
:PROS 408->419|PS00141|ASP_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87821.1 GT:GENE AAK87821.1 GT:PRODUCT aminopeptidase P GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2030680..2032521) GB:FROM 2030680 GB:TO 2032521 GB:DIRECTION - GB:PRODUCT aminopeptidase P GB:PROTEIN_ID AAK87821.1 GB:DB_XREF GI:15157199 LENGTH 613 SQ:AASEQ MFQTFDNKSAPQFGKARVEALRAGFDALGIDGFLVPRADEYQGEYVPECAERLSWLTGFTGSAGIALVTRAQAVVFVDGRYTTQLKSQVDQSVFTGGDLVGAPPSVWLSEHAAQGFRLGIDPWLHTGAELKRLEKALAGKGGSVVLLEKNPLDALWQDRPAEPLEPVVIQPEAFTGILAKEKIASLAETVSAKGADALLVTDPSSIAWIFNIRGNDVPHTPHPLARGIIYADGKADIFLDKRKTGIEAEAYLAQLATQLPPSKIADRLHAIASAKGRVMVDADLTPVALTGAITAAGGSLIEEADPVRLPRARKNKAELAGSAAAHVQDGAAMVEYLCWLDRQQPGSVTEIAAVKALEAARAKVGQAMQNPLKDVSFDTISGAGDHAAIIHYRVTTDTDRILADGEMFLVDSGAQYVNGTTDITRTVAIGTVPEEQRRFFTLVLKGVIAISAARFPKGTRGCDLDPLARIALWKAGADYAHGTGHGVGSYLSVHEGPQRIARLSTQELLPGMILSNEPGYYRPGAFGIRIENLIYVREAEEVAGGDQPMFSFETLTWCPIDRRLVVVSLLTDEELDWLNAYHADVLEKLSPLITDEEVKAWLVAATKPLERAA GT:EXON 1|1-613:0| BL:SWS:NREP 1 BL:SWS:REP 30->611|XPP1_RAT|e-103|41.2|568/623| PROS 408->419|PS00141|ASP_PROTEASE|PDOC00128| SEG 352->364|aavkaleaarakv| BL:PDB:NREP 1 BL:PDB:REP 30->609|3ctzA|6e-99|39.9|566/617| RP:PDB:NREP 1 RP:PDB:REP 11->609|3ctzA|e-101|34.5|595/617| RP:PFM:NREP 3 RP:PFM:REP 17->137|PF01321|9e-12|43.1|109/130|Creatinase_N| RP:PFM:REP 182->312|PF01321|1e-06|28.4|126/130|Creatinase_N| RP:PFM:REP 376->536|PF00557|7e-25|44.8|154/203|Peptidase_M24| HM:PFM:NREP 3 HM:PFM:REP 325->538|PF00557|1.7e-44|40.5|195/203|Peptidase_M24| HM:PFM:REP 17->145|PF01321|7.9e-22|36.0|114/131|Creatinase_N| HM:PFM:REP 183->296|PF01321|1.1e-08|25.9|108/131|Creatinase_N| GO:PFM:NREP 3 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01321|IPR000587| GO:PFM GO:0016787|"GO:hydrolase activity"|PF01321|IPR000587| GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 3 RP:SCP:REP 15->139|1chmA1|3e-16|15.4|117/155|c.55.2.1| RP:SCP:REP 199->264|1flcA1|6e-16|7.7|65/156|b.19.1.3| RP:SCP:REP 314->567|1chmA2|3e-42|18.3|235/246|d.127.1.1| HM:SCP:REP 21->90|1pv9A1|1.4e-07|39.7|58/0|c.55.2.1|1/2|Creatinase/prolidase N-terminal domain| HM:SCP:REP 180->311|1chmA1|3.2e-06|22.8|127/0|c.55.2.1|2/2|Creatinase/prolidase N-terminal domain| HM:SCP:REP 315->575|2bwvA2|5.9e-57|40.8|233/0|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 1562 OP:NHOMOORG 952 OP:PATTERN 1111-122222222221222221--11---2-111-1-11111-----------21222231111-11 1121322122222122122-22111122222122221211-----------1------------111232--------1-2-1111111111-111---11-------111111111111----1--1111111112221111122-------11-----------1----------------11111112222333334332333333222222333222422222222241222222222222222222222223233222222223312122222211221222222222222222222222222222222222222222121213333454242-511333311-112121111111111111111211111111211111111111111111111211221222-11111111111122211112212111112121111112111111111111111111111111111111111111111111111111122111111122122111112211222222211---------11----------------1-1111111-------111111111-1111111--11--------1-11-11111111111111111-1111--1113--111222111112211112121122-------------2111-2-2222222222-222222222222222222211111111121111111111111122221111-----------1------1111111111-1211-1-11-111-1--111111--111--2222111111111-211111111111111111111112111--111111111111---2------1111111111-----1-1111111111111111111111111-111--- 1111111-421-1121221111111111111112121211111111212211211111111111211112112221111112222211-2432225222221233311525233437222223373262DM2-5222222532331232242152343149514255345B32422111J2111124371371111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 603 STR:RPRED 98.4 SQ:SECSTR ##########ccccHHHHHHHHHTTccccccEEEEccccTTccccccGGGcHHHHHHcccccccEEEEEcccEEEEEcGGGHHHHHHHccTTEEEEETTcTTcccHHHHHHccTTcEEEEcGGGccHHHHHHHHHHHHHTTcEEEEccccHHHHHcTTcccccccccEEccHHHHcccHHHHHHHHHHHHHTTTEEEEEEccHHHHHHHHTEEccccccccccccEEEEEcccEEEEcccGGGGcHHHHHHTTTTccEEcGGGHHHHHHHHHHTccTTcEEEEETTccHHHHHHccGGGEEEEcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHcGGGTcccHHHHHHHHHHHHHTcTTEEEEccccEEEEGGGGGcTTccccGGGcccccTTccEEEEEcEEETTEEccEEEEEccccccHHHHHHHHHHHHHHHHHHTccEETTccGGGGGGGGTHHHHHTTcccccccEEcccccccccccccEEcTTccccccTTcEEEEccEEEETTTEEEEccEEEEEEEEcccccccccEEEEEEcccccccGGGccGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHc DISOP:02AL 5-19, 610-613| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHcccEEEccccccccEEEEEccccEEEEccHHHHHHHHHccccEEEEEEcccccHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHcccEEEEccccHHHHHccccccccccccEEccHHcccHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHccccccccccccEEEEEEEEEccEEEEEEccccccHHHHHHHHHHHEEccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccEEEccccccccccccccccccEEccccEEEEEEEEEEccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEcccEEEEEcccEEEccccEEEEEEEEEEEcccEEEccccccEEEEEEEccccccccccHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccc //