[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87827.1
DDBJ      :             DNA polymerase III, epsilon subunit
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  277/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.55.3
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->123 1j53A PDBj 4e-12 35.5 %
:RPS:PDB   4->144 3cm5A PDBj 3e-13 12.1 %
:RPS:SCOP  2->145 1wljA  c.55.3.5 * 6e-19 16.4 %
:HMM:SCOP  1->155 1fxxA_ c.55.3.5 * 2.5e-36 30.3 %
:RPS:PFM   4->142 PF00929 * Exonuc_X-T 3e-14 32.1 %
:HMM:PFM   4->155 PF00929 * Exonuc_X-T 1.5e-20 25.0 152/165  
:BLT:SWISS 4->145 DPO3_THETN 1e-13 28.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87827.1 GT:GENE AAK87827.1 GT:PRODUCT DNA polymerase III, epsilon subunit GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2036440..2037048) GB:FROM 2036440 GB:TO 2037048 GB:DIRECTION - GB:PRODUCT DNA polymerase III, epsilon subunit GB:PROTEIN_ID AAK87827.1 GB:DB_XREF GI:15157207 LENGTH 202 SQ:AASEQ MKTIAIDFETANEERGSACSVGLAWIEDGQIVRVEERLIRPRDMRFSPFNIAVHGIRPRDVEDAPEFPEVMEEFIDDFHGATMIAHNAAFDFSVMRASFDKYRLSYPDLSYLCSVKIARHVWPHLVSHKLNVIAHHLQLRFVHHNAAEDAVVCAAASIAAARALGVAHIRDLPEKIGMVAGRLTSTGYQPCSMKKRTVARVA GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 4->145|DPO3_THETN|1e-13|28.6|140/1401| SEG 146->167|aaedavvcaaasiaaaralgva| BL:PDB:NREP 1 BL:PDB:REP 2->123|1j53A|4e-12|35.5|121/174| RP:PDB:NREP 1 RP:PDB:REP 4->144|3cm5A|3e-13|12.1|141/294| RP:PFM:NREP 1 RP:PFM:REP 4->142|PF00929|3e-14|32.1|137/163|Exonuc_X-T| HM:PFM:NREP 1 HM:PFM:REP 4->155|PF00929|1.5e-20|25.0|152/165|Exonuc_X-T| RP:SCP:NREP 1 RP:SCP:REP 2->145|1wljA|6e-19|16.4|140/168|c.55.3.5| HM:SCP:REP 1->155|1fxxA_|2.5e-36|30.3|155/0|c.55.3.5|1/1|Ribonuclease H-like| OP:NHOMO 315 OP:NHOMOORG 279 OP:PATTERN ---------------------------------1---------------------------------- -----111111-1-2--11-12--1211111--222-121---------111131111-----1-11---1---------1-------1111-111---1--1---1------------------1--------------------1--1---------------------------------111------1------1--1---11-1----1---1-1-221------1-1121211122111222111111111111111111111111112-------111-------------------------------------1-11-22222221211----111-11----------1--111-1111-----1111-----------1---1-------------1-11112111-----112111111----1---1--1-2-----------------1-------------------------------------111------------------------------1-----1---1-------11-1----11111---2-11-1---1-1-----------1--1----------------------------------------1----1-111121122211211111-------------1----1-1111111111-1111111111111111111-----1-1-111111111111111-1111111-------------------------------------1------------------------------------------------1111-----11111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------- STR:NPRED 145 STR:RPRED 71.8 SQ:SECSTR ccEEEEEEEEcccccccEEEEEEEEEETTTTEEEEEEEEEcccccccHHHHHHHcccHHHHHTcEEHHHHHHHHHHHHHTcEEEEEcccHHHHTHHHHHHHHTTccccGGGcEEEEHHHHHHHHHHHHcccccccccHHHHHHHc######################################################### DISOP:02AL 201-202| PSIPRED ccEEEEEEEEcccccccEEEEEEEEEEccEEEEEEEEEEccccccccHHHHEEccccHHHHHccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHcccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHccccccccccccccc //