[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87834.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  449/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.118.8c.37.1
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   50->153 3ee7D PDBj 3e-10 9.6 %
:RPS:PDB   124->264 2cfuA PDBj 5e-04 5.1 %
:RPS:SCOP  43->211 1xnfA  a.118.8.1 * 2e-04 17.9 %
:RPS:SCOP  201->258 1qvrA2  c.37.1.20 * 9e-04 25.9 %
:HMM:SCOP  40->154 2ff4A2 a.118.8.3 * 1.6e-05 17.5 %
:HMM:PFM   121->230 PF12161 * HsdM_N 0.00046 14.8 81/132  
:BLT:SWISS 31->288 Y1543_RHILO 3e-94 62.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87834.2 GT:GENE AAK87834.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2044791..2045657) GB:FROM 2044791 GB:TO 2045657 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87834.2 GB:DB_XREF GI:159140315 LENGTH 288 SQ:AASEQ MKHVGSGAMKGTMRGIAVSLMLVGASVVVTACQSDPDIDITKLGVETDPPDVLYKQGLANMNAGNMTEASRKFEAIDKQYPFTEWGQKALVMQTFIATRTNKNDVAITSGSRFLRQYPRSKDAAYVQYMIGLAYSKQISDVTQDQRAAQRTIEAMNKVVNDYPSSEYVADAQAKIRFARDQLAGREMQVGRYYLERKEYLAAVSRFRIVVEQYQNTNQIEEALARLTEAYYAMGLVDEAQTAAAVLGNNYPDSQWYADSYKLLKGQGLEPRENKGSWISRAGKKLIGA GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 31->288|Y1543_RHILO|3e-94|62.4|258/289| RP:PDB:NREP 2 RP:PDB:REP 50->153|3ee7D|3e-10|9.6|104/112| RP:PDB:REP 124->264|2cfuA|5e-04|5.1|137/627| HM:PFM:NREP 1 HM:PFM:REP 121->230|PF12161|0.00046|14.8|81/132|HsdM_N| RP:SCP:NREP 2 RP:SCP:REP 43->211|1xnfA|2e-04|17.9|162/259|a.118.8.1| RP:SCP:REP 201->258|1qvrA2|9e-04|25.9|58/357|c.37.1.20| HM:SCP:REP 40->154|2ff4A2|1.6e-05|17.5|114/0|a.118.8.3|1/2|TPR-like| OP:NHOMO 451 OP:NHOMOORG 451 OP:PATTERN -------------------------------------------------------------------- 1-1------------------------------------------------------------------------------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1--1-11111111111111111-------------------------111111111111111111111111111111111-11111---11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 73.6 SQ:SECSTR #################################################cEEEEEEEEccTTTcccccEEEEEEcccccEEEEEEEccccccEEEEEccccEEEEEccccEEEEEccTTccEEEEEEEcTTccHHHHHHHHHHHHTTccccccHHHHHHHHHHHTTcHHHHHHHHHcTTcHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHcTTH###HHcccccHHHHHHHHHHcHHHTcccccHHHHTTccEEEEEEETTT######################## DISOP:02AL 1-9| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHcc //