[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87853.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  129/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->66 PF03994 * DUF350 6.3e-19 35.8 53/54  
:HMM:PFM   79->131 PF03994 * DUF350 6e-16 34.0 53/54  
:BLT:SWISS 8->133 YJFL_ECOLI 8e-28 46.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87853.2 GT:GENE AAK87853.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2069732..2070133 GB:FROM 2069732 GB:TO 2070133 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87853.2 GB:DB_XREF GI:159140323 LENGTH 133 SQ:AASEQ MTIYAAGLPAFLSYFSIGLVCFAIFSTIYTRLTPHEEVELIKAGNISAVVAFLGALIGFSLPLASAAAHSVSLPDYVIWAAIGLLVQVLAFYIAKLTMTDLHLKITEGNVAAGLWSGGIAVVIGTLNAACMAY GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 8->133|YJFL_ECOLI|8e-28|46.0|126/132| TM:NTM 4 TM:REGION 6->28| TM:REGION 46->68| TM:REGION 75->97| TM:REGION 112->133| HM:PFM:NREP 2 HM:PFM:REP 14->66|PF03994|6.3e-19|35.8|53/54|DUF350| HM:PFM:REP 79->131|PF03994|6e-16|34.0|53/54|DUF350| OP:NHOMO 133 OP:NHOMOORG 129 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--11111-11------1111----1-------1------------------------------------------------------------------------------------------------------------------------------------------------2221-------111------1-------------11-12--------111-1-111----1--------------------------1--------------------------------1--------111111---------------1--111---111-------------1----1-------------1------------------1-------------------------------------------1----1-----------------------------------1----11111111111-1111111111111111111---1111-11-1111111111111111----------------------------------1---------------------------------1-1---------1-------------1-----11-11--11111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHc //