[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87871.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  347/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.66.1
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->78 3f6vA PDBj 9e-12 42.3 %
:BLT:PDB   118->260 3e8sA PDBj 2e-12 42.4 %
:RPS:PDB   18->74 1bibA PDBj 1e-12 26.3 %
:RPS:PDB   114->298 3b3fA PDBj 3e-23 13.0 %
:RPS:SCOP  5->148 1ulyA  a.4.5.58 * 3e-19 26.1 %
:RPS:SCOP  142->308 1xxlA  c.66.1.41 * 4e-24 31.9 %
:HMM:SCOP  5->193 1ulyA_ a.4.5.58 * 6.2e-32 36.8 %
:HMM:SCOP  116->315 1wznA1 c.66.1.43 * 3e-48 31.0 %
:RPS:PFM   17->61 PF01022 * HTH_5 3e-08 53.3 %
:RPS:PFM   157->253 PF08241 * Methyltransf_11 4e-15 46.9 %
:HMM:PFM   157->253 PF08241 * Methyltransf_11 2e-24 42.6 94/95  
:HMM:PFM   18->62 PF01022 * HTH_5 8.6e-16 53.3 45/47  
:HMM:PFM   236->310 PF01234 * NNMT_PNMT_TEMT 0.00089 29.6 71/256  
:BLT:SWISS 9->74 ARSR_ECOLI 6e-11 47.0 %
:BLT:SWISS 120->308 YCGJ_BACSU 6e-14 31.2 %
:BLT:SWISS 280->334 CARB_LEUCK 4e-04 45.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87871.1 GT:GENE AAK87871.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2088303..2089316) GB:FROM 2088303 GB:TO 2089316 GB:DIRECTION - GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID AAK87871.1 GB:DB_XREF GI:15157259 LENGTH 337 SQ:AASEQ MAFGLDKLVDLLKAAGEPTRFRLLALLSAGDLTVTDLTEILGQSQPRISRHLKLLTEEGLIERYQEGAWAYFRLRQDGEPAVVVRQLLGAASPSDAVLQRDSERLATVKRVRAERAQDYFSRNASAWDELRRLHVSDEAVEGALLKLVGTTPIDSLLDLGTGTGRILQLLSGIYRRAIGVDASRDMLSVARANLDKAGVGNASVRHGDILNLPLEGQDFDLIVIHQVLHFLDQPEIALSEAARMLRPGGRLIVIDLAPHSFEYLRDEHAHVRLGFSHPLMEEWMKKAGLSLERAVDLHSEKASDEALDVTIWVARDQRLLMADDVVQEAVLLRSGRA GT:EXON 1|1-337:0| BL:SWS:NREP 3 BL:SWS:REP 9->74|ARSR_ECOLI|6e-11|47.0|66/117| BL:SWS:REP 120->308|YCGJ_BACSU|6e-14|31.2|186/253| BL:SWS:REP 280->334|CARB_LEUCK|4e-04|45.5|55/1059| BL:PDB:NREP 2 BL:PDB:REP 8->78|3f6vA|9e-12|42.3|71/96| BL:PDB:REP 118->260|3e8sA|2e-12|42.4|132/216| RP:PDB:NREP 2 RP:PDB:REP 18->74|1bibA|1e-12|26.3|57/294| RP:PDB:REP 114->298|3b3fA|3e-23|13.0|185/337| RP:PFM:NREP 2 RP:PFM:REP 17->61|PF01022|3e-08|53.3|45/47|HTH_5| RP:PFM:REP 157->253|PF08241|4e-15|46.9|96/96|Methyltransf_11| HM:PFM:NREP 3 HM:PFM:REP 157->253|PF08241|2e-24|42.6|94/95|Methyltransf_11| HM:PFM:REP 18->62|PF01022|8.6e-16|53.3|45/47|HTH_5| HM:PFM:REP 236->310|PF01234|0.00089|29.6|71/256|NNMT_PNMT_TEMT| GO:PFM:NREP 5 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 2 RP:SCP:REP 5->148|1ulyA|3e-19|26.1|134/190|a.4.5.58| RP:SCP:REP 142->308|1xxlA|4e-24|31.9|166/234|c.66.1.41| HM:SCP:REP 5->193|1ulyA_|6.2e-32|36.8|171/0|a.4.5.58|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 116->315|1wznA1|3e-48|31.0|197/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 558 OP:NHOMOORG 387 OP:PATTERN ------------------------1--1--1-1----------131-511C641-1-1-1-------- 221-1--1121---232-------12-----111113143-3341231----322-11--332-3221332-----------1--11----------------1-21-1-----------1111-1---11-1112---122211-111211---11----112-1--1-1--1------------------12---------1-----1211-1----3-2---------41---------------------------1--1-1-----------------------------------------------1----------1231111211111---22-111-----2---1343-1--2-2-------2--1111-11-111------1-11-11111111111-11221111211-11111111111321112-------------------11-2212------------------------------1121111-11111111-11111121111111112------22---------1-----1---------------1---3-2-221112112-23321-151211122-21--------------------1--111----111----1-----------------1-----22------1111---111-11-122-11112-112211-111111-------1-----------------111-111-----------------1---------1131------1-------------------121121-221121111212-1----1-1----1-----11---21121221121111----111111--------------------------------------------1--31 ----------------1--1432-2-1-------------------1111--1----1--11--1-------1------------1----111-----------------2-----------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 337 STR:RPRED 100.0 SQ:SECSTR EEEEEETTTTEEEEEEEcTHTTHHHHHHTcTccHHHHHHHHTccHHHHHHHHccccTTcEEEEEccccEEEEEccccccccccHHHHTTHHHTEEcccccTccccccTccccEHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHTGGGTTTcEEEEEccTTcHHHHHHHHTTccEEEEEEccTHHHHHHHHHHHTTcTTTEEEEEccTTTccccccEEEEEcccccTTcTcHHHHHHHGGGGEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHGGGGHHHHHHHHHTccEEEcccEEEccGGGcTTccHHHHHHHHHTTTTcHHHHHHHHHHHH DISOP:02AL 334-337| PSIPRED ccccHHHHHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHcccEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHccccccEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHccc //