[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87878.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  120/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.45.1c.46.1
:112 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->104 2f46A PDBj 1e-15 33.3 %
:RPS:PDB   3->94 2eeeA PDBj 4e-04 16.5 %
:RPS:SCOP  6->112 1e0cA2  c.46.1.2 * 3e-04 14.0 %
:HMM:SCOP  1->103 1xriA_ c.45.1.1 * 7.6e-05 24.7 %
:RPS:PFM   4->104 PF04273 * DUF442 1e-20 45.5 %
:HMM:PFM   2->105 PF04273 * DUF442 9.8e-32 39.4 104/110  
:BLT:SWISS 5->104 BLH_AGRT5 5e-12 30.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87878.2 GT:GENE AAK87878.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2096738..2097076) GB:FROM 2096738 GB:TO 2097076 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87878.2 GB:DB_XREF GI:159140338 LENGTH 112 SQ:AASEQ MDIRRIDDEYSVTGQISVSDLDEVKALGFKSIVCHRPDGEEDGQPLFADIAERAEQLGLTIMHVPVGRYGVDADAVTGMVDALDELQRPMLGYCRSGARSTAIYEKTHHLRG GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 5->104|BLH_AGRT5|5e-12|30.0|100/431| BL:PDB:NREP 1 BL:PDB:REP 3->104|2f46A|1e-15|33.3|102/140| RP:PDB:NREP 1 RP:PDB:REP 3->94|2eeeA|4e-04|16.5|91/149| RP:PFM:NREP 1 RP:PFM:REP 4->104|PF04273|1e-20|45.5|101/109|DUF442| HM:PFM:NREP 1 HM:PFM:REP 2->105|PF04273|9.8e-32|39.4|104/110|DUF442| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF04273|IPR005939| RP:SCP:NREP 1 RP:SCP:REP 6->112|1e0cA2|3e-04|14.0|107/136|c.46.1.2| HM:SCP:REP 1->103|1xriA_|7.6e-05|24.7|97/0|c.45.1.1|1/1|(Phosphotyrosine protein) phosphatases II| OP:NHOMO 144 OP:NHOMOORG 120 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-----11------11111111111-11-11---11--122112121112--11--11111121-11111111---11---------------------------------11111111112222221----22-1111111221-1-21111----------------211-1111111111------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------1---------------222222-11------------------------------------------------1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 91.1 SQ:SECSTR ##HHHHHTTcccTTcEEEEEcccEEEEEEEccTTcccTcHHHHHHHHHHHHHHHHHHTccEEEcccTTTTccHHHHHHHHHHHTTcccEEEEEccccHHHHHHH######## DISOP:02AL 1-1,111-113| PSIPRED cccEEccccEEEcccccHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcc //