[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87884.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87884.1 GT:GENE AAK87884.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2102537..2102917) GB:FROM 2102537 GB:TO 2102917 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87884.1 GB:DB_XREF GI:15157276 LENGTH 126 SQ:AASEQ MTARFSLFSSLIAVALLGLPVVVQAASFKELSGQGYKVGALSSNKAGIRGWNLSKGSDRYFCEMRATMAYSGKNGMVSFTSAGRMISLDRNTVAKGLGGSLDLPKYEDLKAGRLRADDVGSCRKVT GT:EXON 1|1-126:0| TM:NTM 1 TM:REGION 5->27| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHccHHHHccccEEEEEccccccccccccccccccEEEEEEEEEEEEcccccEEEEcccccEEEEccHHHHHccccccccccccccccccccccccccccccc //