[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87887.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:88 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   23->86 3dboB PDBj 4e-04 15.6 %
:RPS:SCOP  17->80 2fe1A1  c.120.1.1 * 2e-05 12.5 %
:HMM:SCOP  2->80 2h1cA1 c.120.1.1 * 5.1e-05 17.7 %
:HMM:PFM   47->78 PF01850 * PIN 9.7e-07 25.0 32/126  
:HMM:PFM   18->50 PF06704 * DspF 0.00091 24.2 33/132  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87887.2 GT:GENE AAK87887.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2105478..2105744) GB:FROM 2105478 GB:TO 2105744 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87887.2 GB:DB_XREF GI:159140343 LENGTH 88 SQ:AASEQ MLVAKGRISETKSPQRWYDDFKREAEVIEQPVTADIFIASCFLPQLVHKDPIDRILITTAREHDLTIITRDRVILAYGEAGHVKTLAC GT:EXON 1|1-88:0| RP:PDB:NREP 1 RP:PDB:REP 23->86|3dboB|4e-04|15.6|64/126| HM:PFM:NREP 2 HM:PFM:REP 47->78|PF01850|9.7e-07|25.0|32/126|PIN| HM:PFM:REP 18->50|PF06704|0.00091|24.2|33/132|DspF| RP:SCP:NREP 1 RP:SCP:REP 17->80|2fe1A1|2e-05|12.5|64/130|c.120.1.1| HM:SCP:REP 2->80|2h1cA1|5.1e-05|17.7|79/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 72.7 SQ:SECSTR ######################cEEcccHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHTTccEEEccccGGGGTTcTTccEE## PSIPRED cccccccccccccHHHHHHHHHHHcccEEEcccHHHHHHHHHccccccccHHHHHHHHHHHHHccEEEEEHHHHHHccccccEEEEcc //