[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87888.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->61 2b5aC PDBj 2e-04 38.9 %
:RPS:PDB   1->66 2b5aB PDBj 7e-10 33.3 %
:RPS:SCOP  11->65 2auwA1  a.35.1.10 * 1e-09 9.1 %
:HMM:SCOP  1->66 2a6cA1 a.35.1.13 * 7.2e-08 25.8 %
:HMM:PFM   14->63 PF01381 * HTH_3 5.8e-11 36.0 50/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87888.2 GT:GENE AAK87888.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2105887..2106309) GB:FROM 2105887 GB:TO 2106309 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87888.2 GB:DB_XREF GI:159140344 LENGTH 140 SQ:AASEQ MTGDQIDKSWFSQQLKRKGKSQADLARFLNLDRSAVTRMLNGDRNMSVEEQDRIAEYLEIPVGDVALHRRGGVAGFSENNQTAYSEPAPSGRSGPEAGNVSTTESRHPIFGCMKGTITVMPDVDLTKPVDFEWGEKLYNE GT:EXON 1|1-140:0| BL:PDB:NREP 1 BL:PDB:REP 8->61|2b5aC|2e-04|38.9|54/76| RP:PDB:NREP 1 RP:PDB:REP 1->66|2b5aB|7e-10|33.3|66/75| HM:PFM:NREP 1 HM:PFM:REP 14->63|PF01381|5.8e-11|36.0|50/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 11->65|2auwA1|1e-09|9.1|55/67|a.35.1.10| HM:SCP:REP 1->66|2a6cA1|7.2e-08|25.8|66/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 56.4 SQ:SECSTR cccHHHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHTcccccHHHHHHHHHHTTccHHHHHH#####HHTcccccTTTc######################################################## DISOP:02AL 1-4,13-22,81-101,139-141| PSIPRED ccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHccEEEEEccccccccccHHHHHHHHcc //