[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87893.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:HMM:PFM   8->58 PF06197 * DUF998 6.5e-05 21.6 51/144  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87893.2 GT:GENE AAK87893.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2111389..2111598) GB:FROM 2111389 GB:TO 2111598 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87893.2 GB:DB_XREF GI:159140347 LENGTH 69 SQ:AASEQ MTVGLQFIYPDSATLHSFSAIIRLLCLQLREIPLVIRLSRYVPQLGLLSCFIVLVAITGIQSACGIRVK GT:EXON 1|1-69:0| TM:NTM 2 TM:REGION 9->31| TM:REGION 40->62| HM:PFM:NREP 1 HM:PFM:REP 8->58|PF06197|6.5e-05|21.6|51/144|DUF998| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEcccHHHHHHHHHHHHHHHHHHHccEEEEHHHHcccHHHHHHHHHHHHHHHHHHHccEEEc //