[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87897.1
DDBJ      :             ABC transporter, nucleotide binding/ATPase protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.40.6c.37.1
:352 amino acids
:PSIPRED
:BLT:PDB   6->314 1q12A PDBj 5e-67 43.6 %
:RPS:PDB   8->235 3dmdC PDBj 7e-52 16.4 %
:RPS:SCOP  2->235 1b0uA  c.37.1.12 * 3e-53 28.8 %
:RPS:SCOP  206->349 1q12A1  b.40.6.3 * 2e-18 12.2 %
:HMM:SCOP  1->234 1g2912 c.37.1.12 * 6.3e-77 45.3 %
:HMM:SCOP  236->352 1oxsC1 b.40.6.3 * 4.4e-14 31.1 %
:RPS:PFM   43->162 PF00005 * ABC_tran 2e-18 41.2 %
:RPS:PFM   275->347 PF08402 * TOBE_2 5e-04 37.7 %
:HMM:PFM   43->161 PF00005 * ABC_tran 7.1e-27 40.7 113/118  
:HMM:PFM   275->349 PF08402 * TOBE_2 2.1e-13 28.8 73/75  
:HMM:PFM   171->210 PF09818 * ABC_ATPase 0.00012 27.5 40/448  
:HMM:PFM   16->51 PF03193 * DUF258 0.00024 14.3 35/161  
:BLT:SWISS 16->352 POTA_SILPO 1e-74 48.8 %
:PROS 134->148|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87897.1 GT:GENE AAK87897.1 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2114648..2115706 GB:FROM 2114648 GB:TO 2115706 GB:DIRECTION + GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein GB:PROTEIN_ID AAK87897.1 GB:DB_XREF GI:15157291 LENGTH 352 SQ:AASEQ MSFLTLSNIKKSFGSVQVVHDFNMAIEKGEFVSFLGPSGCGKTTVLRMIAGFEIPTGGSIVINGKDQTTLRPNQRNIGMVFQAYALFPNMNVYENVAFGLKVAGKPKAEIDARVKEMLQLIHLEHLADRYPYQMSGGQQQRVALARALAPKPEVLLLDEPLSALDAKIRVSLREEIRQIQQKLGITTIFVTHDQEEALSISDRIVVMNGGRADQIGSPFDIYNKPATRFVASFVGTLNLIDATVVDSSSNTIRVGEQQITLPKPVDAANGEKITLALRPEAGSLGSDAKGDVAISGLVTSSQFLGSVIRTRLDLGGSTLSFDMFNDPGTAPPAVGERVTLKFAAGDLMLIKD GT:EXON 1|1-352:0| BL:SWS:NREP 1 BL:SWS:REP 16->352|POTA_SILPO|1e-74|48.8|334/366| PROS 134->148|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 138->149|qqqrvalarala| BL:PDB:NREP 1 BL:PDB:REP 6->314|1q12A|5e-67|43.6|307/367| RP:PDB:NREP 1 RP:PDB:REP 8->235|3dmdC|7e-52|16.4|213/318| RP:PFM:NREP 2 RP:PFM:REP 43->162|PF00005|2e-18|41.2|119/123|ABC_tran| RP:PFM:REP 275->347|PF08402|5e-04|37.7|69/72|TOBE_2| HM:PFM:NREP 4 HM:PFM:REP 43->161|PF00005|7.1e-27|40.7|113/118|ABC_tran| HM:PFM:REP 275->349|PF08402|2.1e-13|28.8|73/75|TOBE_2| HM:PFM:REP 171->210|PF09818|0.00012|27.5|40/448|ABC_ATPase| HM:PFM:REP 16->51|PF03193|0.00024|14.3|35/161|DUF258| GO:PFM:NREP 7 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005215|"GO:transporter activity"|PF08402|IPR013611| GO:PFM GO:0005524|"GO:ATP binding"|PF08402|IPR013611| GO:PFM GO:0006810|"GO:transport"|PF08402|IPR013611| GO:PFM GO:0016820|"GO:hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances"|PF08402|IPR013611| GO:PFM GO:0043190|"GO:ATP-binding cassette (ABC) transporter complex"|PF08402|IPR013611| RP:SCP:NREP 2 RP:SCP:REP 2->235|1b0uA|3e-53|28.8|233/258|c.37.1.12| RP:SCP:REP 206->349|1q12A1|2e-18|12.2|115/135|b.40.6.3| HM:SCP:REP 1->234|1g2912|6.3e-77|45.3|234/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 236->352|1oxsC1|4.4e-14|31.1|106/0|b.40.6.3|1/1|MOP-like| OP:NHOMO 49088 OP:NHOMOORG 1172 OP:PATTERN VVLCRLLGaYYVXVcQpJTURURbzPTlnbkYKBDEFDHGHFCWcTYoOR**k8SeSXZOSJMDc19B VdvQ*hggrrqWcTaVXQQ-QmCCa*QQQQQPvrrs****Z*c*v**hsohT**uSUcDDz**k*v****eaWVV*ZYcO*iqCBDACRQPJ6NEHH--GGTLKLcMbNO58888889CABBBBJTRKRWOMTUcTnww**MKM*drmqyhflimVWPJNINGigbl***aJPGMJKJPKKFIkeiWSymAbgy*******************y****gr***enuwxrrs**XghhhifdggggggeYdaYc*gca**aQZYjusQR**dVPakjhhjrqusonvutsturtpouxosrbabaabcdfdcba*nogffpnqkn***********k*mq***dffZ*sjvn*hoWN**tlcejsTbjbrmPeabOfXVVLJMKKLgW***bTv****************-tv*nj*p***VB**************JMN**********VUVVVVVV*ekLVmf*555665556656879A6898688897685MEEGFF************************n********AP**u*t*py******broPVLVneJKKIKJJURQetoe**VhazlctwgesMgfbWXdmYcdffeu*b*KNNSHLMMNLFBBDCDDCDDGUEILONpnuQwUZKSLxOSUVTLTdTQQTSUbYVZZ5-DJWPM11-322*x**X*zx***y***vw-*xxy*y*zyz***tuwutt*****gieljklllmlmljkmklj*qnpssquS3************33HHCEBCDLLNLPL*s*aZZZaVKORMMXOTgNPRSPHVIQUvczywwz***z****k***EEDBCEDCEJhqo*rrssrz*vzzRRTPOPPKNMEDDD78MVRQLLOOAA899999*BXCDCDH-DDFBGI8LJKBJKDHEAAAZkwXVs*rqrFhQ 1244eaI-XI4BGTLGBDB9EFAGAGBCB6757IFE7C8BAAA566DBDFGDNGEFF989BB74663524627754512454453536-9B6B96A8778639OLE3FXkbMPNXWSGFD8CMJff8h9**c4cMfIGC8V8EVMAMBCBVCA*FONJpEU*FiHS8kSV*MUQHEFEA*BC9EEoXb*DoeBFgOUUR ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEEEEccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHcccccEEEEEEEcccccEEEEcccEEEEccccccccccEEEEEEcccEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEccEEEEEEEEccccccccccccEEEEEEcHHHEEEEcc //