[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87903.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  149/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.102.1
:415 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->396 2zblC PDBj 1e-71 40.5 %
:RPS:PDB   17->408 2afaA PDBj 2e-20 32.7 %
:RPS:SCOP  17->408 2afaA1  a.102.1.3 * 2e-62 38.4 %
:HMM:SCOP  10->417 2afaA1 a.102.1.3 * 4.2e-105 37.3 %
:RPS:PFM   42->372 PF07221 * GlcNAc_2-epim 3e-70 48.9 %
:HMM:PFM   41->392 PF07221 * GlcNAc_2-epim 5.5e-126 42.3 345/346  
:BLT:SWISS 11->408 YIHS_ECOLI 6e-70 38.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87903.2 GT:GENE AAK87903.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2124071..2125318 GB:FROM 2124071 GB:TO 2125318 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87903.2 GB:DB_XREF GI:159140352 LENGTH 415 SQ:AASEQ MPEDDHNSRNWNTLPWHRQWLVKQVEGLFDFFQHRALNPAGGFFDLDAKGAPLQANDPVRGIHASARMVHCFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATKQGYGHAFVLLAASSAKTVGHPLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNYRGQNSNMHLTEALMAAYEATGDSNYLTKAERIADLVIRRRAGELDFRVPEHFDENWTLDKAYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMPVAAKSLFVQSMALGWDREKGGFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIWSTIANNFIDHENGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPAAGSLTTVIKESGGDY GT:EXON 1|1-415:0| BL:SWS:NREP 1 BL:SWS:REP 11->408|YIHS_ECOLI|6e-70|38.2|390/413| BL:PDB:NREP 1 BL:PDB:REP 11->396|2zblC|1e-71|40.5|378/417| RP:PDB:NREP 1 RP:PDB:REP 17->408|2afaA|2e-20|32.7|376/399| RP:PFM:NREP 1 RP:PFM:REP 42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim| HM:PFM:NREP 1 HM:PFM:REP 41->392|PF07221|5.5e-126|42.3|345/346|GlcNAc_2-epim| GO:PFM:NREP 2 GO:PFM GO:0004476|"GO:mannose-6-phosphate isomerase activity"|PF07221|IPR010819| GO:PFM GO:0006013|"GO:mannose metabolic process"|PF07221|IPR010819| RP:SCP:NREP 1 RP:SCP:REP 17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3| HM:SCP:REP 10->417|2afaA1|4.2e-105|37.3|402/0|a.102.1.3|1/1|Six-hairpin glycosidases| OP:NHOMO 175 OP:NHOMOORG 155 OP:PATTERN ---------------------------1-11------------------------------------- ---------------------------------------------11-1-----1-----111-------1-111111-----------------------1-----2------------------------------------1---------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------1----------------------1-----------------------------1--------111-------------------------------1--111111111112--1-1---1111------------112--------------------------------------------1111111111111311111111121-1------1--------11---------------------------------------------------------------------------------1--1-21-2--2---------1---------------------11-----111-1---1--1-111-111-1-111111---------11111111111-1-1-----111------------------------------112--------------------------2----2212-2121-222------------------------11111111111111---------------------------------------------------------2- ------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 397 STR:RPRED 95.7 SQ:SECSTR ##########TTcHH#HHHHHHHHHHHHHHHHGGHGGGEETTEEccccTTcccccGGcEEHHHHHHHHHHHHHHHHHHTcTTHHHHHHHHHHHTTTTcEcTTTcccccEEccccEEEccEEHHHHHHHHHHHHHHHTTTcTTHHHHHHHHHHHHHHHTEETTTTEccccEEcTTcccccccEEHHHHHHHHHHHHHHHTTccTHHHHHHHHHHHHHcccccGGGTTccccEEcTTccccTTTcTTccTTcccccHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHHHHHccccccccccccccTTcccccccEEHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHTcTTTcccccEEcTTccccccccccccccTTTHHHHTGGGccccccHHHHH####### DISOP:02AL 1-5,415-416| PSIPRED cccccccHHHHHHccccHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccEEEEEHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEccEEHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHccccc //