[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87911.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:320 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   224->316 PF06059 * DUF930 1e-14 45.1 %
:HMM:PFM   222->318 PF06059 * DUF930 1.3e-28 37.1 97/101  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87911.2 GT:GENE AAK87911.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2133420..2134382) GB:FROM 2133420 GB:TO 2134382 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87911.2 GB:DB_XREF GI:159140356 LENGTH 320 SQ:AASEQ MQQVSAGKWRRGGWAVPVSVLLHLVVVALFFFELPERIAEPQEPESVNVELVPPPEEKKEEAAPPPAAAAKAEKPQPPPPPPPAPPKEDVKPTPQPQATLPSISMRPEEMQADKEDKPGKAEEAEKSQASEEPASQPEKAAEEKPAPPAANSDLQASAEQGEIAVSPVKEETPPEQPPVPQAKPAEEKPAEVAEKKPAKLPAVKSLLSSALLTPAQRRQIFGDLPPRRRIVQLCQTEALAQIREVYPATRGMYGFSDTGGRISGNVLDATGGAFNVGDVWHDVTFQCDVDVDNYAVTAFRFKIGDVITPAEATKRGFTGR GT:EXON 1|1-320:0| TM:NTM 1 TM:REGION 14->36| SEG 16->34|vpvsvllhlvvvalfffel| SEG 53->88|pppeekkeeaapppaaaakaekpqpppppppappke| SEG 120->150|kaeeaeksqaseepasqpekaaeekpappaa| SEG 167->204|pvkeetppeqppvpqakpaeekpaevaekkpaklpavk| RP:PFM:NREP 1 RP:PFM:REP 224->316|PF06059|1e-14|45.1|91/101|DUF930| HM:PFM:NREP 1 HM:PFM:REP 222->318|PF06059|1.3e-28|37.1|97/101|DUF930| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,30-248,320-321| PSIPRED cccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEEccccEEEEEEEEEEcccccEEEEEEEcccccccHHHHHHcccccc //