[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87919.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:RPS:PFM   11->157 PF11158 * DUF2938 1e-32 48.3 %
:HMM:PFM   9->158 PF11158 * DUF2938 1.8e-61 48.7 150/150  
:BLT:SWISS 72->156 GGGPS_METST 8e-04 32.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87919.2 GT:GENE AAK87919.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2147577..2148056 GB:FROM 2147577 GB:TO 2148056 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87919.2 GB:DB_XREF GI:159140360 LENGTH 159 SQ:AASEQ MLELIWRGIAMGIGGTVFMDIWAIILHRFFGQSAPNWAPVGRWFWHVPKGRIFHDSIATATPYEHELALGWISHYAVGILYGIILALVVPAAWFANPSFIEPWIVGIVTVGAGWFLLQPGLGIGWAASKTPNPTKVRILNLVAHTIFALGMYAVALLMS GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 72->156|GGGPS_METST|8e-04|32.1|84/243| TM:NTM 4 TM:REGION 5->27| TM:REGION 73->95| TM:REGION 100->122| TM:REGION 137->159| RP:PFM:NREP 1 RP:PFM:REP 11->157|PF11158|1e-32|48.3|147/150|DUF2938| HM:PFM:NREP 1 HM:PFM:REP 9->158|PF11158|1.8e-61|48.7|150/150|DUF2938| OP:NHOMO 62 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111---1----------1---11-11-111----1---------1--------------------------------------------------1---11---1111---11111--11111-1--111-------1---------------------------------------------------------------------------------------------2---1---1-----------1-------------------------------------------------------------1-------------------------------------------------------------------------11111-1----1----11---1111------------------------1---11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccEEEEccHHccccccccccccHHHHHHHHHHHHHHHHHHHcHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //