[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87920.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  329/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   105->216 2ai8A PDBj 1e-16 19.4 %
:RPS:SCOP  108->228 1eb6A  d.92.1.12 * 6e-15 10.8 %
:RPS:PFM   95->301 PF04228 * Zn_peptidase 4e-75 61.8 %
:HMM:PFM   1->301 PF04228 * Zn_peptidase 3.3e-129 56.4 291/292  
:BLT:SWISS 95->305 YPFJ_ECOLI 1e-68 54.0 %
:PROS 182->191|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87920.1 GT:GENE AAK87920.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2148098..2149015) GB:FROM 2148098 GB:TO 2149015 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87920.1 GB:DB_XREF GI:15157320 LENGTH 305 SQ:AASEQ MEWKGRRQSDNIEDRRGMSAGSGDPFSRGGMRVPIGRRGGGIGIGGLLVILLISWVLGINPLTLLTGGDMSMDGGGTTQSGTQQSGTRPQGQSSDETTAFVRTVLAETEDTWSGIFQSAGETYQKPTLVLFSGQVSSACGNASAASGPFYCPGDRKVYLDTNFFKELDQRFGASGDFAQAYVIAHEVGHHVQNLTGVLPEFNRRRQSMSQTDANKMSVRVELQADCYAGIWGKFTEQKGILETGDLEEALNAAHQIGDDTLQKQTQGYVVPDSFNHGTSAQRMEWFKRGFQNGRVEDCDTFSANI GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 95->305|YPFJ_ECOLI|1e-68|54.0|211/287| PROS 182->191|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 1 TM:REGION 45->67| SEG 28->59|rggmrvpigrrgggigiggllvilliswvlgi| SEG 66->94|tggdmsmdgggttqsgtqqsgtrpqgqss| SEG 136->147|ssacgnasaasg| RP:PDB:NREP 1 RP:PDB:REP 105->216|2ai8A|1e-16|19.4|108/166| RP:PFM:NREP 1 RP:PFM:REP 95->301|PF04228|4e-75|61.8|207/263|Zn_peptidase| HM:PFM:NREP 1 HM:PFM:REP 1->301|PF04228|3.3e-129|56.4|291/292|Zn_peptidase| RP:SCP:NREP 1 RP:SCP:REP 108->228|1eb6A|6e-15|10.8|120/177|d.92.1.12| OP:NHOMO 340 OP:NHOMOORG 329 OP:PATTERN -------------------------------------------------------------------- -12-211111111121111-11--1111111111113111-1-11111111-111111----1-321--12----------------------------11111-111-1------------------1-----------------21-------11--------------------------111-------------------------------------11--------1---------------------------------------------11-1---1-------------1111111111111-11---1111--------------------------11----------------------1-11--1-----11111111111111111111-111-1111111111--11111111111111-1--11-1----1------------1---------------------------------11111-1111111111-----11--------11-1111--1111111111111-1111--------------1111------1------------1------1--111--1---------------------1--1-----------1111---111--1-------11---------11---111111111111-1111111111111111111111----1111111111111111111121111--111111111111------------------111111--------111111-11111-11111111111111111-------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 58.0 SQ:SECSTR ###################################################################################################HHHTTEEGGGTccccEEEEcccTTccccEEEEEEEEEEEEcccccEEcTccEEcccccEEEEEEEcTTccEEEEEEcHHHHHHHHHHHHHcTTTHTTccGGccHHHHHHHHHHHHHHHHTcHHHHHHHHTcccccccccTTTTHHHHHHHHHHHHHHHHHHHHHccccccccccccH############################# DISOP:02AL 3-6, 13-29, 67-95, 202-218| PSIPRED ccccccccccccHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccHHHHccEEcccccEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccccccc //