[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87924.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  7->51 1mntA_ a.43.1.1 * 0.00027 28.9 %
:HMM:PFM   15->42 PF11903 * DUF3423 4e-06 42.9 28/73  
:PROS 26->39|PS00287|CYSTATIN
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87924.1 GT:GENE AAK87924.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2154370..2154558 GB:FROM 2154370 GB:TO 2154558 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87924.1 GB:DB_XREF GI:15157324 LENGTH 62 SQ:AASEQ MIGRPSGPQRVAFPLRIEPAILNAIRQTASGELRSINAQIEILLKEALRHRATADAAKEPTG GT:EXON 1|1-62:0| PROS 26->39|PS00287|CYSTATIN|PDOC00259| COIL:NAA 33 COIL:NSEG 1 COIL:REGION 27->59| HM:PFM:NREP 1 HM:PFM:REP 15->42|PF11903|4e-06|42.9|28/73|DUF3423| HM:SCP:REP 7->51|1mntA_|0.00027|28.9|45/0|a.43.1.1|1/1|Ribbon-helix-helix| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 56-62| PSIPRED cccccccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //